SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028845 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028845
Domain Number 1 Region: 129-436
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-99
Family Protein kinases, catalytic subunit 0.0000000000838
Further Details:      
 
Domain Number 2 Region: 3-111
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-16
Family Pleckstrin-homology domain (PH domain) 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028845   Gene: ENSSSCG00000010872   Transcript: ENSSSCT00000033298
Sequence length 457
Comment pep:novel chromosome:Sscrofa10.2:10:18101700:18268833:1 gene:ENSSSCG00000010872 transcript:ENSSSCT00000033298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPNTFIIR
CLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDA
STTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLT
ESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEI
VSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAP
EVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKS
LLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYF
DEEFTAQTITITPPEKCQQSDCGMLGNWKKKKKKTII
Download sequence
Identical sequences ENSSSCP00000028845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]