SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029420 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029420
Domain Number 1 Region: 42-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.12e-38
Family SCAN domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 307-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.97e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 264-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 137-183
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-19
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029420   Gene: ENSSSCG00000012689   Transcript: ENSSSCT00000035399
Sequence length 418
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:126803558:126818085:1 gene:ENSSSCG00000012689 transcript:ENSSSCT00000035399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMRHLKVNACLYPHMEALWETKGSVKESCSQSKQSSPQMDSLGPESARQHFRSFYYHEA
PGPLEAVSQLQELCHQWLRPEIHSKEQILELLVLEQFLTILPRDTQNWVQKYHPQSIKEA
VALVDRFQREPGGISNESSLTFEDVALSFSEEEWQMLDPAQKILYNNVMQENYENVISLG
LKLKNDTGNDQPISLSTLEIQASGCKALREARVKVAPKTTGKENHGSTRRVRKRHRAFLG
KKRKKLSTCRQELPKHTDLHEKGHAGEKPFKCQECGKSFRVSSDLIKHQRIHTEEKPYKC
QQCEKRFRWSSDLNKHLLAHQGIKPYRCSWCGKSFSHNTNLHTHLRIHTGEKPFKCYECG
KRFIQNSHLIKHQRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHRRRESCPASSPSRT
Download sequence
Identical sequences ENSSSCP00000029420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]