SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029634 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029634
Domain Number 1 Region: 830-1121
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.71e-87
Family Complement components 0.0000158
Further Details:      
 
Domain Number 2 Region: 1202-1330
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 6.54e-30
Family Alpha-macroglobulin receptor domain 0.0018
Further Details:      
 
Domain Number 3 Region: 665-717
Classification Level Classification E-value
Superfamily E set domains 0.00000000364
Family SVA-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029634   Gene: ENSSSCG00000004485   Transcript: ENSSSCT00000035127
Sequence length 1368
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:103137101:103292068:-1 gene:ENSSSCG00000004485 transcript:ENSSSCT00000035127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGPLLVTAAHLVCMWSSVLAAAPGPRFLVTAPGIIRPGGNVTIGVELLEHSPSQVTVKA
ELVKMAANLTVSVLEAEGVFEKGSFKTLILPSDPKSNLIQQWLSEQSDLGVVSKTFQLSS
HPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVALQTPLYCSLNSKSLNGTVTAKYTYG
KPVKGDVTLTFLPLSFWGVKKNITKTFKINGSANFSFNDEEMKKVMDFSDRPSEHMYLSS
PGPVEILATVTESLTGISRNASSNVFFKQHNYIIEFFDYATVLKPSLNFTATVKVTRSDG
SQLTPEERRNNVVITVTQKNYTKSWSRWDSMDQEAGPIQVINHTVPDNGVFKIEFPILAD
SSELQLKAFFLDSVSSMAVHGMFKSPSKTYIQLKTRDENIKVGLPFELVVIGNKQLKELS
YMVVSRGQLVAVGKQNSSTFSLTPENSWAPKACIIVYYIEDDGEIINDVLKIPVQLVFKN
KIQLFWSKANAEPSEKVSLRVSVTQPDSVVGIVAVDKSLNLMNISNDITMENVVHELELY
NTGYYLGMFMNSFAVFQECGLWVLTDANLVKDFIDGVYDSVEWAERFVEENEGHLVDFHD
FSLGSSPRVRKHFPETWIWLDTKMGSRIYQEFEVTVPDSITSWVATAFVISEDLGFGLTP
APVELQAFQPFFIFLNLPYSVIRGEEFALEVTIFNYLKDATEVKIIVEKSDEFDILMASN
EINATGHQQTVLVPSADGATVLFPVRPTCLGEVLITVTAISPAASDALTQRILVKAEGIE
KSYSQSILLDLTDRKLQTTQKTLSFSFPPDTVSGSERVQVTAIGDILGSSINGLASLIRM
PYGCGEQNMINFAPNIYVLDYLTKKKQLTENLKEKALSFMRQGYQRELLYQREDGSFSAF
GNDDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGHQKSNGEFWEPGRVIHSE
LQGGNQSPITLTAYIVTSLLGYKKYQPNIDVQESINFLESEFDKGISDNYTLALVTYALS
SVRSPKAKEALNVLTSGAEQEGGMQFWVSAVSRLSESWQPSSLDIEVAAYTLLAHFLQNQ
VSEGIPIMRWLSRQRNSLGGFASTQDTVVALKALSEFAALMNTEKTDIQVKVVGPRSSSP
VKFLINTENRFLLQTAELAVEEPTAVNISASGFGFAICQLNVIYNVKDSRSSRIRKSIQD
QEAFDLDIAVKDNNDDVNHLNLSVCTRFLGPARSGMALMEVNLLSGFTVPSDSLPLSETL
KKVEYDVGKLNLYLDSVNETQFCVDIPAVRNFRVSNTQDASVSIVDYYEPRRRAARSYNS
RAKLSSCDLCGDMNACGGCDRTVSASPPHLAISLLCCFILLFSLLFWL
Download sequence
Identical sequences ENSSSCP00000029634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]