SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030344 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030344
Domain Number 1 Region: 13-124
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.45e-20
Family FHA domain 0.0036
Further Details:      
 
Domain Number 2 Region: 113-183
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000509
Family BRCT domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030344   Gene: ENSSSCG00000006127   Transcript: ENSSSCT00000033100
Sequence length 330
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:51264134:51283413:1 gene:ENSSSCG00000006127 transcript:ENSSSCT00000033100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKLIPAAASARDPYRLLTGVEYIVGRKNCDILIEDDQSISRNHAILTANFSITNLSQTD
EIPILTIKDNSKYGTFVNEEKMRTDFSQTLKTGDRVTFGVFKSKFRVEYEPLVACSSCLD
VSGKTALSQTILQLGGLTMNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFL
KAVQSKKHPPEIERFYPPVDEPAIVSKNIDLSGRQERRQIFKGKTFVFLNAKQHKKLSAA
VVFGGGDARLITEENEEEDSFFSAPGTCVVDIGITDSQTLIPDSQKKWLHSIMDILQRRG
LRLIPEAEIGLAVIFITTENYCDPRGQPST
Download sequence
Identical sequences ENSSSCP00000030344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]