SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030387 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030387
Domain Number 1 Region: 150-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000662
Family LIM domain 0.059
Further Details:      
 
Domain Number 2 Region: 210-276
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000788
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000030387
Domain Number - Region: 114-153
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0274
Family LIM domain 0.039
Further Details:      
 
Domain Number - Region: 273-296
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0931
Family LIM domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030387   Gene: ENSSSCG00000012293   Transcript: ENSSSCT00000036662
Sequence length 554
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:48066375:48076996:-1 gene:ENSSSCG00000012293 transcript:ENSSSCT00000036662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRLISDFQRHSISDDDSGCASEEYAWVPPGLKPEQVYQFFSCLPEDKVPYVNSPGEKYR
IKQLLHQLPPHDSEVQYCTALEEEEKKELRAFSQQRKRENLGRGTVRIFPVTITGAICEE
CGKQIGGGDIAVFASRAGLGACWHPQCFVCSTCRELLVDLIYFYHAGKVYCGRHHAERLR
PRCQACDEIIFSPECTEAEGRHWHMGHFCCFECEASLGGQRYVMRQSRPHCCACYEARHA
EYCDGCGEHIGLDQGQMAYEGQHWHASDRCFCCSRCGRALLGRPFLPRRGLIFCSRACSL
GSEPTAPGPGRRSWSAGTVSTPLAASTASFSAVEGASETTTKGTSTEPASAAGPEEPARF
LRGAPHRHSMPELGLRSAPEPPSGPPGQPDPHPEDGAFGRQSAPRVSFRDPLVSDGGPRR
TLSAPPAQRRRPRSPPPRAPTRRRHRRHHHHHHHHHHHHHHRRHSSRRRHHQCDSGSGSD
SGSCSSSSTSPSSESSEDDGFFLGERIPLPPHLCRSVPARDTAAETPNSPSPQLPGTSRP
GMSRQARDKNCIVA
Download sequence
Identical sequences ENSSSCP00000030387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]