SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030485 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030485
Domain Number 1 Region: 65-135
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000212
Family DEATH domain, DD 0.017
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000030485
Domain Number - Region: 4-37
Classification Level Classification E-value
Superfamily DEATH domain 0.00141
Family DEATH domain, DD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030485   Gene: ENSSSCG00000012795   Transcript: ENSSSCT00000036679
Sequence length 233
Comment pep:novel chromosome:Sscrofa10.2:X:142289052:142290169:-1 gene:ENSSSCG00000012795 transcript:ENSSSCT00000036679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFGGWRRAGGGGAGRGARGAPAPRPDD
PRPAAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVRILTHLQLLRARDIITA
WHPSAPFLPPSSTTPRPNSISAPLEAKAPSPRKLHSSASTLLSPAFPGSQTHSDPELGPH
TSPAALQPPALSAAPLSTQVAKPRKLRVPLAGGPLFVLLAPPRDPPGHPGLLR
Download sequence
Identical sequences ENSSSCP00000030485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]