SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA000391-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA000391-PA
Domain Number 1 Region: 162-428
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-23
Family YWTD domain 0.0003
Further Details:      
 
Domain Number 2 Region: 40-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000827
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 39-144,432-465
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000124
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA000391-PA
Sequence length 635
Comment pep supercontig:SscaA1:JXLN01005229:2015:4344:1 gene:SSCA000391 transcript:SSCA000391-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIVSVRSFYATPSMIVEIYPMKLIQNCDRSLPSNTIDDCDDKNHFVCDNQQECIAIEQR
CDRNADCSDGSDEFYCDIIPFNSSTLIRFCVGNESRTNIDCIRNERCNEFGICSGHYCRP
VSEKKVQCECFNGFVLDADSNEYCTLPKLLNSTNRLVYSIGNHLRMIDWSIKEQNQIKIT
DRNDFCHFQYDSDHLAPSSSIAFDFNLYSNYFLASNQLNQCYLDRIDKSKQFSLLERIFT
PTILIRSLSIDWINDLVYLINSETNTIEALKIIKPDIVYVIADRLHKPQDIEVNPIDSWI
IWSEHGRIVRQSQDNLEKIILINDDIVEPRGLAIDHIIRKIFWLDSQLNSINSMNFDGSQ
SRSIFQSIRFLLIPIDIDVFDNHIIWTNQNSLLMIDKFARNKTIIEISREEPDVRITSVA
ILHSIRQPRFESDCSIDCPFRCMNRSNHCYCPFPYELNEQNQCVNGQQSFVQKDVPDFYE
IKRFAIILFAIASMLFILVCVVNCWRFISFSFKPKPYRSMRLESLRRNRLIENESTSALA
SNAIDGNVSSSRIIDLDHNTNKALLPVITDRPDDFSSGYSSVLSDQSSSNKPKRLMEDEA
DDDDDDDDDDDDDDDDDFHGTDKTTITKKKCHFYV
Download sequence
Identical sequences A0A131ZXA4
SSCA000391-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]