SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA000622-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA000622-PA
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000166
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA000622-PA
Sequence length 121
Comment pep supercontig:SscaA1:JXLN01010286:5874:6396:-1 gene:SSCA000622 transcript:SSCA000622-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKYQCQASNQHGTTISNSTELKIRFAPYCKFKSTLAYGLSLFESSALVCEVESNPKPN
SFMWEFEKEIHLKSFRSENYSSILNYRPNSTQHYGTIECIAKNDVGLQQIPCKYHIIDSG
I
Download sequence
Identical sequences A0A132A4A9
SSCA000622-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]