SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA001052-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA001052-PA
Domain Number 1 Region: 2153-2407
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.37e-55
Family Protein kinases, catalytic subunit 0.00000692
Further Details:      
 
Domain Number 2 Region: 78-117,144-294
Classification Level Classification E-value
Superfamily Fibronectin type III 2.73e-19
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 1147-1235
Classification Level Classification E-value
Superfamily Fibronectin type III 3.42e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 349-589
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000102
Family YWTD domain 0.0021
Further Details:      
 
Domain Number 5 Region: 1836-2050
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000161
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 6 Region: 607-711
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000007
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 7 Region: 1604-1669,1706-1803
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000216
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 8 Region: 721-967
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000471
Family YWTD domain 0.0074
Further Details:      
 
Domain Number 9 Region: 1238-1385,1444-1511
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000824
Family YWTD domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA001052-PA
Sequence length 2585
Comment pep supercontig:SscaA1:JXLN01012332:16353:25068:-1 gene:SSCA001052 transcript:SSCA001052-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIKKCRKGCHYWYLEPSSCFHICREDVGGSEKSDPISPYSNGQDNYCAFGCNHAHTVYA
DHIHNILTIHGALSSVRLVANSLSNDSLTIEWNSIPDYLNLNLSFQIQWKYANLPSKWLD
VGDSGLSTGIRFAANQNKIANRFTRITKAHLIGLNAYTNYLFRLKWTLLPSPYSDLLSEP
SATITTLPYGVPRSACVIVNCLAISSNQISISWKAPVFSNAPIIAYSLYLINERTGHRTV
KDIHIHWYQHQSDQTKVHNYVFNDLSAQTKYTIIIATHNNFGEGPRCQKSLFTLEKHPSK
NNDVDTNYEQFEQFKLYLASSKSITRRNIDMLLEEEVLYHLTDYVENAEITSMAIHIAYR
FLFVADSSGTIRRILLNKNSINQVVRIVNGINQPTHLNVDWLNDRLYWLEEPNYLMRSNL
DGESVESIYIDSLYSNQKPIDFKVDPYNGYFFWLQTNIFNRTMIYRLDMYHLDNSKPKAK
LRSNVELIYQSDVYIPTFTLNFLNYRLILPMIQTNSIHSITIDGNDETSIRDNSNYGVIN
DEQLHSETIKKLSTIANMLVYNQKLFFISGENISWEEYHTNETIYYYNTFMTDSKLISIA
MMDAQCQPIPVPLTPVENVEAVFLDTSAKISWQKPSLFGASGRGAWQKWRYEIAIQESDD
AEAIHYAEVNDMTQCDAVELKPNTEYEIKVRAFTEAGYGAWSSKFIGKTLAEFDETQDEP
YILVASNDSLTQTHLDGRFKQKLISKSKIEGTSITEIELYDDLVFLNTEKQILVINQSDF
DTFEAPNLKVLIERSNAQSIAIEWMAPKLYWSNPLERMICRSNLDGSQVEVLPIITYAEE
IVIDSIRGLLYWSTSSSLRLSLINGQKDSQSVIVKSHYIKSVSIDQDNSKLFWISEEPAI
LEDQELKLLLNEIDLFQSISDVHQLKADEIHITRIQESISLIGPIGFFANRFWWLDQENH
HILVSNRSCKTFATIRQLSGVNTFRIVSEKSSMVSKLEQFIDQKEVRVVPTSVDPSLIRI
VGTWENFTIQWDPISNVNYGEVFYDLTLENDRQKHESKATNFVLRETEFVLPEYLKPSKP
YSEIRIAIRAFTYWASAKQVMVTLHSPSSIPSKPISVRIFTYLKQDTDNIIFGNENVQHL
SNEAVTAEARWNKPENPNGLIQSYTLSLWTVDSNLANNNKVSSIINKVIPNQLSYNLTDL
KPNSTYYFEVRATTDIGEGPPSDVVQFKTFRSEPPMKLLLSERDSIKEIDMDSLKERSVI
KSLAPSAIDYHMAENRLYFVEDGRFLKSSNLLMRERYSDQNLGQKGQSGNFSILAYFSHP
ITCLSMDWIARRLYVSTVDYRQNQSTIWLYEEETSSKHPIQTVNGFIHTLKVDPFRSMLL
WTEQILIGNRDFVSIKQCFLSINGSLCLDKREYFQNPSRDRLCNCTHTPNISGAFMLITD
EFSPIQKIIYFDRNEQTFVRCSDGCFCKRITSFIETHSPPNSILFDRIANKLYWKNETIN
GLIYSTRLVSNHLEDDFKQQINAIEIGKFARSLAHLSIQKYPNNLECLIPPTYLKVNLSI
IEQSSTFVRIRIDLNRTEQISNNFFVQKCPWIQSTKMTLSLASIRYKIKLSQTNHTECFE
ENHFDFNSNEKCKSIITYNQTILIANLQPFTNYTLSLELDNFYLTLLKNQSQKRLDLARN
ASLVMISKKDFISKNHQYDHLKVGFFRFATTESKPAPPREIKAIVESPEKIKIIWKSPEV
LNAPHVAYEVRWYSLNNSSEMKVRSERQSWVLDWANKSTEEQHSIYLNDIVPGNFYNVSV
RVYAIQKRLKANGNNYQIDHYQFHESEPITVRAYDSPNNVQLKYVSSRQIDIEWYTSDDS
IIESHEIWYKQEESKPSTNSSESSVWNLFSKERTKPSHQYSYQLKRLKPNTGYQIKFILK
YRPFGQKYEWPRPTKYLRIVTNMSVPDGPESLEIETISSEISDRGKHTSIYKLSWDAVDS
NSDSIVYYHLYKSRIPDDSEVREKISVLERKNEWELAYNGTDTFWILSGLKIGAQYNFRL
FASNRLGVNSKEWAQTTRPFWFGQNLDGKHPDEYSTFASIKNSEIQLLLAFVIFSLLALC
FIIFSLWSLRSDKNPAKNLDSDRAILSSSNSNNPIELIPWQRRPHPHFPNTLYVNSTVNG
ENIDLSDIEVIDAKEITLTKLLGKGAFGEVHEAILHKNNQRVAAKVLNRNSSKDEDNCNF
LKEAKFMSKFKHPHILEMLGICLNYESSSLVIILELMEAGDLLEYLRSNRPQASLTIAKP
LTIDDLMSICIDVAKGCVYLEQKQFVHRDLAARNCLVSNFDPSKRVVKIADFGLTRGLYQ
QNYYRKEGGLMPVRWMSPESLLDEYVKSGGILERPPFCPVEMYSLMKKCWSFEKESRPSF
AQILKHLEALRELFKKTFDEKNCPTLVNNKNYQRNHSHQIKNFQDQIKIGIDQKFSPTDY
EFNDPNFMHKATIDTNYCNNLINENAIHKITYPSLVCHSATNTTMTSLEDPTSNCSTMPR
LMNISPALVLETSSIISRRLSKNQLMPDLGNYTAFNHPETVDTLYSNAHIQSDFVEKKLF
SDKLI
Download sequence
Identical sequences A0A132ABM1
SSCA001052-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]