SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA001081-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA001081-PA
Domain Number 1 Region: 93-182
Classification Level Classification E-value
Superfamily Integrin domains 0.000000837
Family Integrin domains 0.0031
Further Details:      
 
Domain Number 2 Region: 5-96
Classification Level Classification E-value
Superfamily vWA-like 0.00000267
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 3 Region: 312-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA001081-PA
Sequence length 796
Comment pep supercontig:SscaA1:JXLN01010445:1671:7185:-1 gene:SSCA001081 transcript:SSCA001081-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVMLGGILIPNNGKCQLFGNRYLKSRIYDYPSMYHIAELAQLKKFHIIFTVSDQVTQQY
QTLSDVIGSNARVASLKVNDETIAELIDEVYRNISNQIELGIEDNPDHIDIEIWTNCGNA
KGPFIRTSKCSFVGKPKIEFEIKIKLKHCPQSNSSSIARIGLLNKNEAVSIEIDPICQCA
CEIFDFETNSSKCSFNGTFSCGICTKCNGIRSGKNCECDPLKPIDSRKPDFHCRPDSDSR
PCKGHGQCVCGQCVCDEMFAGIFCQEDQSACFRNGVKCSNHGQCVQSRCVCDSTFTGRFC
ECPLQNDTCLTNNPNGQLCNGRGECQCGRCKCLVPTSIGSHCQHCPQCDQQFHCRLLRSC
VPQFREQFCLTHFDPISNTSIEHDCDFDLCNTKIWHHLFEFKEIEKIDRNKKFNNGSFEI
APETTWYKAQFLILGLISILIFKCVTNYLDRKEYERFKKEIAEANFALLENPLYKEVTSQ
FKNPVVINQRDCYPNETPIFVHTAAATNGKYFQRRQVIRRTWAREASKYNMRVLFVMGVP
KDLSIERSLKAEADLNHDLLQFNFVENYYNLTLKAISLLKWSYRHCSQSLYMVKTDDDVV
LNMPMLYQLVKQRKIPSGLTGLVMTTPANREQGHKWHMPEHLYPKNSYEFLAGFSYLLSM
DKLKSFLKTIVTYPGPILDIDDLFLTGIVADYGRIRRNNSFRFKFFCGTDVCTMETSLAM
HACPSAKNSEYMYRFWKNADRLSCYKHFRINRNFRRPRRSLNVSDSKNLEEIESKFIEHL
IQNNLLVGFRFRSIAS
Download sequence
Identical sequences A0A132A417
SSCA001081-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]