SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA001105-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA001105-PA
Domain Number 1 Region: 108-238,266-332
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.06e-38
Family Laminin G-like module 0.00073
Further Details:      
 
Domain Number 2 Region: 354-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.34e-22
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 3 Region: 10-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 4 Region: 681-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 5 Region: 552-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000606
Family EGF-type module 0.019
Further Details:      
 
Domain Number 6 Region: 590-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000737
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA001105-PA
Sequence length 1873
Comment pep supercontig:SscaA1:JXLN01015218:5587:12288:-1 gene:SSCA001105 transcript:SSCA001105-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQKYECDTEINLCFSNPCQNQGQCVRKEGGYYCDCLDGFFGKNCEINLRSDVCIVNNPC
LAGSRCLINSINSTPSSSSSSLISTSLNGTASNESSNIQRSNDQLYQQSSSFVCADCPNQ
EWSSALCQLRTRSFVTGSYLTFSALKQRYRLNLKLRFATRQPNGLLLYNGRYNEQHDFIG
LELINGRVYFSYSLGGINRAQVSVGHRLNDGNWHQIEVNYVNRSATLKLDNCDEAFLSAV
DRYDLGPKFACANRTTLILENRCSDRMQTCFRFLDLTGPLQIGGLPPLPTEFQVENIDFN
GCISDLQIDHSPVDFNIFVANNGTMIGCAAKQHFCMPNSCNEHGKCENSWNGYICRCDDG
FTGQDCLEKTDAIRHFKGDGFLMFSPNLQPLSYPWLVSFDIKTVARNALVLAIQLGQSSM
VRFEIIDGKFSYSVDDRPPIMIDEIDINNEKWHHIEARWLATGIMLSVDYGQYIKKQRLE
GTDILGLYIAKVTIGGHDTPDEITDAYMYRSQLPQFVGCIQSVDVGNSKNSWLRPTLEDN
VYQGCQNSLNDHKCQSDPCPTNSDCIVKGMNSYECRCHHGFIGKHCIPVCELNPCAYGST
CVAANNSYGYRCLCDRSHSGFYCEDRLPETCPADWWGSPICGPCNCDVSKGYDGNCNKTT
GECSCQANRFQPPGSDVCLECDCYTLGSHSSRCDRETGQCQCRSGVVGRRCDLCPSPFAE
VTNRGCEVIYDACPRTFTDGIWWDRTSFGSKSIRRCPIGSTGTAERVCLQTEGWLKPNLF
ECLSDTFLDLQEQWKIIKDSDSRQNETTLLNTQHSIRLINDLRSAINSTEGFYGGDVQLI
FQLVRRIIQNELQQSGLNLTHKQDRHFLRNLCESTSAILDPRYASIWEKIADFDQGPEQF
LRLFNQYSEVLINNQRDTFTEPFEIATKWLVFGLDTVATNELWDISQEFANKKSLGIQKS
ANTIHQRFARSIDSGEERLISSEFLDYSLNPDPSTLGSSDRDDSLRHSNPAVIIPKYNNY
PIRKQNIDDITKVIIPLRLLNVESLDDLKHSFAKNPNHRSTTQQNALIAYTVFVSMAHFL
PSQTDSTIRQRFAMPIKSNTPIVTLTMKPANSSQDHFLTKSLHPKLRFRFRTLSREGRSI
PQCVHWSFPSLNVATSGISNRKSTSRGRWSSKGCELKGYYPPQRFRSSYDYINCSCDRAF
AMAVLMDVSGDEFYFDESFAQITVSYIFTLTSLILLALTYSLLSLARGMDTNSITIHKNI
VICLFMTELIFMLGLRVRIKLIQFESLCKLVAIFLHYSFQCLFTWMLIESIHLYRMLTEI
RDINRGPMRFYYFLGYGSAAIIVALSVGVRADQYGNHLFCFISIFESVIWGLIAPICLII
ILNLFVFLLAIQASSQFKTNVCDYGNLRTLLWLSIILVPLLVVLWILALLSINDTVEELH
YAYSLSTLICALYIFIAYCLSNRCVRNNIQMIWIKFVRGNNSCNNNGSDESFSGTRTSIT
SRNGQGGYYHSGSLFDVYGLNQNVLAVNTMRAVISSSSTTSRSTLTKCSTGIVEPTEGMD
PESTDDEFRNRGRSHHYRHKCRRRHHSRHCRSRRKERLTETGSSDDNSRDFSMELASSHS
SDAEEGVASNTNNDSQKDLMQQQQENQINQLIQDQKQSENHSANLRSLSSINQQSSDLSS
NAPTVIYGQRTGLPPGATPVLLKQVDPNTAHLIASTINSRSNLLAMTANVGEMNCNHYST
TTANAKSLAQPPASTEHIYSYARKSNQPNQPSHYSTLGPGSTVNPVDDVGLPPIEIGTQY
RSHYQSIKENPFASTHVRLVQSQSSTSKAKSNDSVAESSSSSLSNTIDSKTLSNDQPNTS
QQQDELEERAWKM
Download sequence
Identical sequences A0A132AHL1
SSCA001105-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]