SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA001271-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA001271-PA
Domain Number 1 Region: 2803-3062
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-48
Family YWTD domain 0.00000353
Further Details:      
 
Domain Number 2 Region: 1978-2240
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-48
Family YWTD domain 0.00000905
Further Details:      
 
Domain Number 3 Region: 1027-1286
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-47
Family YWTD domain 0.00000488
Further Details:      
 
Domain Number 4 Region: 316-537
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-39
Family YWTD domain 0.0000186
Further Details:      
 
Domain Number 5 Region: 1359-1609
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-37
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 6 Region: 6-219
Classification Level Classification E-value
Superfamily YWTD domain 1.1e-35
Family YWTD domain 0.0000566
Further Details:      
 
Domain Number 7 Region: 1679-1895
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-35
Family YWTD domain 0.0000552
Further Details:      
 
Domain Number 8 Region: 905-1018,1287-1331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000107
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 2320-2364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000236
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 10 Region: 690-729
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 11 Region: 3393-3433
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 2446-2489
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 2589-2625
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 14 Region: 3357-3395
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 15 Region: 854-894
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 735-772
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 17 Region: 3144-3185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 18 Region: 2623-2663
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 3526-3564
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 20 Region: 770-812
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 21 Region: 2286-2324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 22 Region: 617-651
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 3484-3520
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 24 Region: 2496-2532
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 3107-3146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 3231-3268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 27 Region: 2723-2761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000018
Family EGF-type module 0.045
Further Details:      
 
Domain Number 28 Region: 3189-3226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 29 Region: 3442-3486
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 30 Region: 654-691
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 31 Region: 3314-3353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 32 Region: 818-854
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 2411-2447
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 34 Region: 2675-2711
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 35 Region: 2747-2796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000394
Family EGF-type module 0.011
Further Details:      
 
Domain Number 36 Region: 3267-3309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000995
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 37 Region: 2365-2406
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000109
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 38 Region: 241-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000136
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 39 Region: 2539-2579
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 40 Region: 2240-2300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000184
Family EGF-type module 0.017
Further Details:      
 
Domain Number 41 Region: 3065-3106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000599
Family EGF-type module 0.01
Further Details:      
 
Domain Number 42 Region: 1617-1666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000373
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA001271-PA
Sequence length 3566
Comment pep supercontig:SscaA1:JXLN01012695:18:10991:-1 gene:SSCA001271 transcript:SSCA001271-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNATAASGLDFHYAKNILFWSDVETRKIYSINLDPNRPTKFTKEISVFYTWTPMSIAIDW
IANKIYICDTHNQKIDIMEFDGSHHSIVISQNLTAPLDIALDPTRGLMFFTDNDNINRAL
MDGTQRKTIVSNFIYKATGITLDYVTQRIFWCDSQLDQIVTVNYEGQERHTIIRGSTKVP
SPVRMTVFENYAYWTDSTRQGVLRLNLYKTSDIEILYRERTIVKEPRSIKSVHALRQPIV
FNPCFTDNGKCEHMCVLTRNGFDNSFALGYRCACDIGYELADNLRSCRKIEEFLMYSQQK
FVRGIILEPKISGFTDAIVPVVSRSARFVGLDFDARTNHIFYSDVILDVIYKIKVDGTGR
ENVLASQNEGVEGLAHDWISHNLYYIDSRKGTLNVISVKNSTYRRVLLKNLKRPRAIVVH
PNRGYIFYSEWERPANISRAYLDGTNVMIFRGVLLGWPNGLSIDYENDRLYWCDALLDHI
QHANLDGTDVKTINSPRIKHPFSLVIHREWLYVTDWRLDAILRINKLTGADEKIINTVEE
GSRLYGIRVFSVDAQNIDTLHPCLYTNGDCQKFCFAIPENDTNQLSVRCGCPYGEKLAED
GHNCILDPVKEPPLQSCPNSWDFTCENQRCIPKSWVCDGDNDCLDGSDEQQNCTQPCSSR
DFKCASGRCVPMGFKCDKDNDCGDFSDEIGCANITCSANEFTCENGRCISMSWKCDSEND
CGDGSDEGDSCKEKTCSFFQFTCPGSGHCIPESWVCDGENDCIDQADEKNCPPIVCSRNQ
FKCADRKQCLHESYHCDGMKDCQDGSDEKDCPQLSPNQCDPEKQFQCKTSRICIPKLWYC
DGNPDCEDNSDEPQSCGQIVCPTNHFKCDNSRCVFKSWICDGRDDCGDNSDEDKRHACGA
VRYECPSDQWSCPNVTNRCIPVKNICDGRADCPNGSDEGPGCGLVSCKSQNCLHQCKETP
WGPLCLCPPGEKLNGTTTCIDIDECEQIGTCSHNCFNEKGGFKCFCEPGYQLENHTYCKA
LNRTEAYMVISNRKSILIANITNVSLERIPVRVENVVATASEMSTGVIYWYDMHTKKIYR
IQNRTSEPEVVINSGLDLVEGLAIDWIAKNLYWVDSRLKTIEVSTSDGRNHIVLLSQNIS
QPRGICLDPREGARILFWSDWGENPRIERMGMDGSERKVIVSTKIYWPNGLTIDIPTKRI
YFADSKLDYIDFCNYDGSDRQQVLAHNHYLLHPHSLTIFEDTLYWTDRQLNRVLSCHKFR
GSNQTVVSHLVSQPLGIHINHPVVQPEEPNPCVKAPCSHLCLLSPSSPGYTCKCPPGYGQ
DRTLVGGRCIPIETPYLMAMKTSQIFDLSLTPNEKSIGYFTPIIGIENGYDFDYDKQEGF
IYYVQLREEDKENGTLYKVSLTGGNQTKFLPDGIVGAPYCLAFDWLGRNLYVGNKKSSNI
LVIKTDGDKNYRRIILSNDGTEKGVAKPKSIVLDPMQGKLYWLDEGGVGVPQKLAKSSMD
GSDPQILIKDSLHQVEALTFDFNNRRIYFSQSFVGVIESIDENGKDRRTIITSSSGIAKP
QGLSIYNNRLYYLDSIYEKIVRVNLPDGSNAISIEDNSPNLANLKIYSKRSGLENHPCRI
GNGGCQQLCIPDSNNQRKCLCSTGFRTDGQTNCQPYKSFAVVSLLNKMQGFSLEDHAEAI
QPIAGPGHNILHIDVHVVKNHIYWVEYNPGERNGIYRIKPDGSEKSHIISDGIGSNGIRG
IAIDWIAGNLYFTNVFPHETYIEVSHLDGKNRMILIKTTTDAPREIAVNPIKRYLYWIDY
GQFPKIEKALLDGTNRTPIVVTGISNPRDLTIDIVTHDVYWVDAREDAIQKVSFSGGRRQ
YVWRNLPTPYGASILGSQIYWVDRNLRTIFRGSKLFEDAQTQIPEPFKSNLDTLRDIVIF
DAQNQPPGDSICSLRGDRICDQLCFAMPSGMDLQFKCACSSGMLDKVDGKKCQPLEEYLI
FTTRKEIRTINLDESISSPPVMPRTNLTNVVGLDFDFANKKVFFTQIRPDGGISSYQIKP
TDDINHPILSKGINPEGIAFDWTNRKIYWTDSANRSIYSMNEDGSQIVMIARVERPRAIV
LDPCEGYIYFTDWGKFGNNGKIYRTTMAGNFKRTIINDNLTQPSGLAIDYEERKLYWTDA
LREKIERSDLNGTNREILISATIYPFALTVFGNYIYWTDLQLRGVYRANKYTGSDMIELV
KRLEESPRDIHVFSSQRQLCDKNPCQINNGGCAHSCHQAPNQTFECRCSTGFKLANENRM
CVPENISCDETKFSCTNGKCIPRLWACDGDDDCGDSSDEDAVFCSAHTCGPNEFRCGNGR
CVFKTWRCDHENDCGDGSDEDDCVYPPCAEGEFTCVNHKCIPIAQLCNGVNDCKDANTTD
ENHINCPTNKTCPVDHLKCSNTNICVEPYWLCDGDNDCGDNSDENVMICSQRTCPPNSFR
CPNNHRCIPATWYCDGDDDCGDKSDEPEDYCKSDQRTCFGDLFTCNNGNCIPRIYICDGD
NDCLDNSDEDERHQCETRTCDPEREFTCTANKNWGRSQCIPKRWICDGDPDCVDGADEDI
TLHSCPPPEPCDVDQFRCNNNRCISKEWVCDHDNDCGDGSDEYRNCTFRDCKEDEFSCRN
TKCIKKTYLCDGEDDCGDGSDENLPKCHENANKSRCASYEFACKTNTQCIQSSLVCNKKL
DCEDGSDESPHCNVNECLKTEINQCEHQCIDEMIGFHCDCNPGYRLAIDGKACEDINECV
DVKSVCSQYCSNTPGSFYCKCNDLYYERMLDGHTCKRIDNVEPWLIFSNRYYLRNVSTDG
HLYNLIKMELKNVVALDFDYRTERLYYADVGNKSINRIFINGTGEETIIRHEAHGLEGIA
VDWVGRKLYWMDRTSKHIDVSELDGTHRKTILSRGMSDPRAIVAHPKIGFLFFTDWGHHA
CIGKIGLDGRNFSRIITYEKKLVWPNALTIDYFSDKLFWADAHLDYIEYSDFDGKNRHTV
LSGNSVPHVFAMSVFDDWLYWTDWNTKGLARAHKFTGANYQVLRNTSHRPYDIHVYHPLR
QIAHDNPCGENNGGCSHLCLISPGGQSFTCACPNNFILLRDNKTCIANCTKGQHRCGGND
DRCIPIFWNCDGDKDCRDGSDELNCPPFQCKPGMFQCRNNSTCISRIRICDGVHDCTDGS
DESFCDNDCGEHSFKCQLTGRCVPSSWQCDGDNDCSDGSDENPLICHHRECDKDTQFRCD
NGKCIPKLWHCDFDDDCGDNSDEPAHLCRNRNCSTGWQKCPSRLNYRCIPSWLFCDGKDD
CRDNSDETHPESCPVCHKTGDFKCKNDRCIPLRWRCDFEDDCGDNSDENPSMCSELYREC
SESEFQCNNRKCVPSRWRCDHDEDCDDGSDEINCLEHQCKPEQFKCKSGHCISNKLVCDG
NKDCKDVSDELNCPPRFPNGRHCAESSFQCNNTVCLRNEFLCDGDDDCGDGSDESESMCQ
NFECDPSKKFQCHNKKCIPLWLICNGFDECGDGSDENNHTLCRKWPTLCSSNQYKCANDR
CIEMSKVCDHFDDCGDLSDEKGCHQG
Download sequence
Identical sequences A0A132ACR3
SSCA001271-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]