SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA001714-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA001714-PA
Domain Number 1 Region: 125-371
Classification Level Classification E-value
Superfamily vWA-like 4.85e-77
Family Integrin A (or I) domain 0.000000493
Further Details:      
 
Domain Number 2 Region: 352-458
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-19
Family Integrin domains 0.0013
Further Details:      
 
Domain Number 3 Region: 635-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.15e-16
Family Integrin beta tail domain 0.0024
Further Details:      
 
Domain Number 4 Region: 543-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number 5 Region: 23-74
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000492
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA001714-PA
Sequence length 787
Comment pep supercontig:SscaA1:JXLN01009961:727:3296:-1 gene:SSCA001714 transcript:SSCA001714-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYKTTYFEYKDTNSPFPEQLREASQCITKTNCRDCIRTKLCSWCNVPGNYSHNRCDITSN
LQEHGCSSLYLYAPQPQFNLEEDEELSNKTDENTDPIQMKPQRISLKVLPNIPQTFQVTF
KQALDYPVDLYYLMDLSKSMEDDKAKLAELGHVLAQTMQNLTNNFRLGFGSFVDKTVMPY
VSIVPEKLKAPCYGCAAPYGFKNHMSLDTDSSYFVQRVNDTQISGNLDAPEGGFDAIMQA
IVCQNDIGWREKSRKLLVFSTDAGFHYAGDGKLGGIVRPNDGECHLDRDGVYTESITQDY
PSISQINRKVREHHVNIIFAVTKDQFHIYNQLVGNNNHSMSLIEGSSAGMLAGDSSNVVQ
LIVDEYQKITSAVELKDNATNNIRMTYASECLSQKKEQTSVCKGLRVGDHVVFDITLMVE
SCPPNENDWQQTIKVYPVGLNDALYIDLEMICKCDCEKDAQEKSPECGGRGSYQCGICNC
DDNYYGRRCECDAKNSDPAKEEASCFRGNDTKVCSGRGTCRCGECECFKRESPDEEVTGK
YCECDNFSCDRFEGLVCAGPDHGTCECGACICKDGWSGPDCSCKVGNEGCIKDPTTGKIC
SGHGECICGQCVCFNNETEQYTGQFCDECPTCKKHCDLYKDCVQCLVFNTGPLAEDQCRN
CTINPITTNELDSKEGELCVVWDENDCVFNFKYQYDEHEELVYIYAQETKDCPEPVNVLA
IVIGVIVGIVLIGLAFLLIWKLLTTIKDRREVAKFNEERLNAKWETGVNPIFKKATSTFK
NPTYSGK
Download sequence
Identical sequences A0A132A158
SSCA001714-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]