SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA002068-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA002068-PA
Domain Number 1 Region: 287-439
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000518
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 434-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000176
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 475-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000958
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 4 Region: 205-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000136
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 5 Region: 516-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000192
Family EGF-type module 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA002068-PA
Sequence length 725
Comment pep supercontig:SscaA1:JXLN01010277:210:2730:-1 gene:SSCA002068 transcript:SSCA002068-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNPQKVWSITRRNSLLVFSRLTSCCNRGIVWSVRNRKCSTQNHSNTNHSIRMISCKEIFK
YCCEQKIRQQQCDRGIFAAQFLLQTSKLSCERQFLYDRNNPLIESYRCCSNCLQGITIAS
KYQSKLKCEEYREKIQSNFLNQNYLPNTFDECCLDLIENNDNNDSQQSLRKNFSNRISRD
SKIESNDDSFEIDTEQFMKVYLRLRCDNTIGSYRCVRILDCGTGYLVNADTNECEDIDEC
LANTHFCSEDFRCRNTKGSFKCERFRCQNGLKLIDGICRNVTCSQLDYVFNFTSLTCQPR
PNPCDNDPCPIDQQCSLDENDRNRFVCQKFCEQGYQFNRTSKKCEDIDECDTGLARCSSD
KICQNFNGYYRCVCREGFHLNDRYQCVDIDECLSIDIMNECWQQNKICHNTIGSYSCRCD
RGYYWNESTKQCSDIDECKAEWNRCEHDCINIVGSYRCQCRSGFRLKVNQHNCTDINECD
IEPRKCFGLCQNTIGSFECRCPDIGFKMSTSNRCEDIDECLDNDACPLGTHCINLYGSYQ
CVNFVCPWMYSFNRTDLVLQCRWPENNSERPYNRYHTIDQIYMNIFPNQTRHITKLSRNY
FQLYAIRFDSNFRFYHHQMRPRFEFRFKSAEWQTISPHRLADFDPDTIEIEARFNRTSEA
IKLASLNDFELRTNLGQNEAIIVIVRPLFGPQKIQLEFYAEGYRSAKFQNHFIQINLFIN
EFDQF
Download sequence
Identical sequences A0A132A367
SSCA002068-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]