SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA002159-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA002159-PA
Domain Number 1 Region: 1050-1152
Classification Level Classification E-value
Superfamily SEA domain 0.000000157
Family SEA domain 0.01
Further Details:      
 
Domain Number 2 Region: 1192-1228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000305
Family EGF-type module 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA002159-PA
Sequence length 1532
Comment pep supercontig:SscaA1:JXLN01010789:1398:6513:-1 gene:SSCA002159 transcript:SSCA002159-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRKPFTPRYTHPISRSRIRMRVSSRTSQIPIESTSILEEISSSPTLNVPVSSSISVYEP
ISSPVLLEPSSTTAESTEHSTTMDSTESLQSLSSQPLSSQSTPTRPNIYRSRVVLRTRPG
QSLLTGQSKMIRISSRLIRPSSQDVPLHTPTLETTSLTPEQSDHSARANKFVRVSNGVTL
IMSSKVATPTRPLTLKPTLVTGAAVMMKNIMPGNYQNELGDSKSIDRENESSKENAAIDR
SFSTIETSQFLRTSTLLSTMTYYATLFNGSTSSITPIEDIKTEYITFPDTTVITRTLKPS
IIDTSASIDSDRYDAIRTDRLSTIPKLMSTSSKAISTTTKSTYTTLTHYITLFHGSHTIL
SSIEEISPTVVTEYIGQSQTDTIGLKPSILNSEDFTTTPNIRFTQQSIDLVQQSKNLYGK
LMPSVSTLFTTHTYFTTLFSGTTSIIQSREETTHSLITLYVPSSQTTPSSSKTMISTIEP
TSSLKGVNSFTSTESVAMQPSLHGSLADGNLQTSSTDSSHSLSTTSTMSDSTDAVVYFTN
FILPSSRPDSENTIDGAKGPLLNHADLTLIGDRPQLSTILENGIIQSSRPVFDQHLPIQT
QSPTIKPGAIIELTDLLDGANLAGNIGEAIKDIVQIFAKGQKNSNILKNPTMETDIDRTS
LVGEELSPPKDGATVSQLETPIYIPIHEDRSTHIPINSSPVLIIPNEVSKSIDFDTESIN
LDNLMIPPVAYMPSPMLTKIYYPSSSAPIQPDDSGPSIWINPSFTVEPVFDSTMKSHTNT
FDQTLEPIFTTTMTTATTRPSLMVGQSNIVEVSVAHQPESTVVVARKESELTTKYITKVD
SYPETTVMTTTKIYYTRDSPLTITSSFTSTMPIKTTVTTIVGDRTTTNTYSEEIIKPTKS
TSVLHTFTTAIVSQPGSAPRQPLSNTGPVLKPTRKPGVSRFRPPSKATEPPKIFKTSHRP
RQPYKPSPTPPPDFDLDPNQQSGIVKKTTKYSLPKTTTRPSFLDLDQCKPGCNTANKEIC
KEFDGKFKCDCRPGYIKRTGNDVCLELQNFIVLVRVLQIGDEKLEWNTNLMNHSSQSYQN
IARLARTQLNNAYESITSMKENYIGSDVLEINQAQDGFGVLVNMTIHLTESNNIDEDLIR
DELSRTLSSSSSSSSHQTSISTNSDLYESIGHQSSSESLPSPQRIVADIEDVIDFDECSS
DQYNDCASSARCINEPGSYRCECLNGYPDLDLSFPGRICASEIKACEFCYGRGDCYRDET
GQISSCKCHRMYLGLLAIFIPVVAILFIITICSIVYCCRKWRNRALVKGLRNFGAYGPNM
IGSTLDRKAMLETSSDNSDPLRSHISYEGPGITSTDATLPRDYHRRRRDSDNLHHYHHHH
GMMEPYDSDPLGSYPNGLAVTNSTGGGGGGGTGASMPYNFSTQFMIPRVRNTSSTNVNNN
GGSGNNLRSNDRNHPHHHHCHHYNGQNGPNDSHNHHSHHSHHHHHHHLNHTHHNHQSSFE
ESNVSKGSAQHHNHHLHSHHHQHRSSHQYSAW
Download sequence
Identical sequences A0A132A5R9
SSCA002159-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]