SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA002674-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA002674-PA
Domain Number 1 Region: 111-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-35
Family Laminin G-like module 0.00048
Further Details:      
 
Domain Number 2 Region: 346-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.44e-27
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 3 Region: 25-96
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000574
Family I set domains 0.091
Further Details:      
 
Domain Number 4 Region: 278-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000943
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA002674-PA
Sequence length 566
Comment pep supercontig:SscaA1:JXLN01012231:6732:8502:-1 gene:SSCA002674 transcript:SSCA002674-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLINKKSSINFDDDDDDLAEKYLNDVGKNFYLDCNHPFNSSSVLFEWNKFDHQHKHDSLP
NDVVIFTNGTILLANMKPSDFGSYICKATNSIDWKISRKVSIIQMRDMVPRFEQNPISYL
SLPTLANSYLRFDLALSVRPEKSNGLIFYNSGGRNDSDYIALGLRDSFIEFIFDLGGGET
RIRSLKPINLNQWHRIGIVREKRSSKLKIDEEDFVTGVSDSKFIGLDLTKPLFVGGVPNS
FHKKIHYFDGNFVGCIHHLNLNSKMIHLIENPIESVGITPCTICLTTSCSNGGVCEESLF
DRDGYECRCPNGFSGKNCESFTDECYDGRCMNGGRCVESYPSKKIVCECPFGTIGSNCEQ
NVTILEPMFSNGAYLTFRTLSNSLNRLNIEMRLKPNFFPKSIKDQDAFDDNHLLFYCGQY
LNGSGDFVAIIINNRTIEFHFDTGSGPTAIKNNLVLFTDQWINVIVKRFNTEATLTVDAG
DRFSTVSGRSVGKTIGLNLNTPLYLGGYHRSQLTLPTSLKHFSFFNGCMNKVDHCLSAWN
IKILMFFGARVIITENGVLKQDTHAQ
Download sequence
Identical sequences A0A132AB44
SSCA002674-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]