SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA002703-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA002703-PA
Domain Number 1 Region: 1041-1285
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-43
Family YWTD domain 0.00000243
Further Details:      
 
Domain Number 2 Region: 322-532
Classification Level Classification E-value
Superfamily GFP-like 2.72e-39
Family Domain G2 of nidogen-1 0.00028
Further Details:      
 
Domain Number 3 Region: 274-315,544-629
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000816
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 915-1034
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000212
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA002703-PA
Sequence length 1343
Comment pep supercontig:SscaA1:JXLN01012783:30603:35302:-1 gene:SSCA002703 transcript:SSCA002703-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAMKSRFFSRFTLYTLILLISRTSRIFSLSIEELYPFGPSVDESLKKEADVSSQEITLS
VPITYYQNQFQSIYVNDNGLVSFITEVPSFYNARFPLQYPIIAVMYSNVDTRAVGNVYYR
ETKEPSLLDRATGDVVRHFSGGNRFRALSVFITTWHQVGRFDKIGDLKNTAQLVIASNGT
DSYAFIFYPEDGIQWIVAQDNIENTHDAQTQAGFMSEGRFYLMPGSGTEQVKNYPIMSNV
MRKGMFVYHIGNTDIGNIGLPDRDYDVELSTLTNQLETCSNARLPCVPSANCFEYSNGIC
CECKKGFIGNGRICISENKNIQVNGKITGEINSNKLEDNSFIHFYIATQEGRVYSSMNQL
KADFGYDMQSLMIAISHIAGWLFAISINEAPNGFTLTGGVFNRSVDVIFPQTGHHAIIHE
QYLGLDIFNVLGMKIDIRGTIPTIPSVSTLSMEDYQLELTRVSPGTLKSRVTIPFNFGPN
TLDMSMIIDETIMFEECPHKSFDKEKLTTRLNIYRNHLEYDHENQATRYAFYESKISYLT
DRNPCDQIDCGQYSACIVEGNDFRCVCEKGFQQLYSNTEQMNPKRITCIDIDECRSGICD
PNAQCFNEIGSFRCRCYNGYVGDGFSCRLSSSSPSSSPLFPDENGCNNIHCDRNAECIST
KNYGPRCICKENFYGNGTFCQPIQSNVDDCRMLYICDMNAECRPNRLLGRHMCVCKAGFR
GDGIVCTEESESCEKLNNCGANAECIADEASNYNYYCSCNEGYVGDGYTCVAEINADDCN
VLNNCHRNGMCVLIDSNSKTYQCQCKPGFTGDGYRCVNSSFVSPCVGLEGCSSNADCVFD
PTMGTNVCRCRSGFIGNGLVCEESNECNLNENSCDQNAECLFDDQTLRYYCRCKLGFIGN
GMRCLIDENADCSIVNDCDKNATCVVDPLTLRYYCKCNAGYTGDGKSCKKQVSCNILNTC
DVKAECIAYNDDYRCRCLPGFVGDGFTCRPSRPCREDRSICDRNAECIFNDHLREFSCRC
HYGFIGDGYQCAPVPQIDGDYILFAQGMTVLKMPLEEDQQEKGAPLFIESDQTIVGIDVD
CLTGFIYWSDLVKGNLYKANHNGTSAEIILEGYTTAPEGIAIDWVSRNIYWTDSSKRTVE
VANIEATLQKVVIEDNLVNPRGIAVHPGTGKLYWSDWNREAPKIEYSDLDGKHRAILIET
ELSLPNNLVIDYDRDELCWTDAGLDRIECIHLMSLNRRVVYAHASYPFDLTVANQNIYWT
DWETKTIHQIHRNGGIAKRLEIPLGGQGSLYGLVAVPRKCPRISNACAVNNGGCKHLCLP
NGHGRSCVCPDNAYHEDDICNEV
Download sequence
Identical sequences A0A132ACX8
SSCA002703-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]