SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA003128-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA003128-PA
Domain Number 1 Region: 496-685
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.87e-35
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 2 Region: 100-231
Classification Level Classification E-value
Superfamily L domain-like 1.47e-31
Family Ngr ectodomain-like 0.0023
Further Details:      
 
Domain Number 3 Region: 425-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 4 Region: 305-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000048
Family EGF-type module 0.026
Further Details:      
 
Domain Number 5 Region: 343-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000672
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 6 Region: 470-509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000298
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 263-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000086
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 8 Region: 388-423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000261
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 699-736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000975
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 2-60
Classification Level Classification E-value
Superfamily L domain-like 0.0000964
Family Ngr ectodomain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA003128-PA
Sequence length 813
Comment pep supercontig:SscaA1:JXLN01012861:13056:16019:-1 gene:SSCA003128 transcript:SSCA003128-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILNLQNNPLNCNCHLKWLNRLLNRKTSDKIFLGNIRCQSPNNLQNVPLEDVELEDFKCD
EDEEEAECGPDGLCPSRCTCFGTTVRCSRQKLKRIPKYIPLTTTELYLDMNEISVIPKEI
NRLNDLTLLDLSNNQISLLSSNQFENFTKLHTLMIGFNKLQCIERDAFKGLIALKKLNLH
GNDISILPKDSFNDLATLTHLAIGENPFYCDCSMRWLAEWIQKTNTENGIARCFEPNLMR
GKLLISALPKNFICTGKIDSYILAKCDACYNFPCENGASCISGSMHTYECRCPPGFHGAN
CQFKIDACFGNPCNNGGTCKVLEMGRFSCHCPSGFRGHRCEINIDECAEQNQCQNNSTCV
DDIGSYRCECQPGYTGYFCENKIEFCKKDNNPCKNQGECIKDEANNSYQCKCATGWSGKN
CTINEDDCIDNMCENGATCLDKISGYECHCPIGYSGEFCEIPPNVDLLLQQTSPCQHHDC
RHGVCFQPLGSQDYECKCSPGYTGKRCDMLASISFRANSFVELNEDFDLRTKSLMFKFKF
ITRKENGLVLYLRGDNDQHLAVEFFKGRIRISLNVGNYPVSTMFSYEQVDDGRFHQVYFE
LNKKNFTMIVDGGHSRSIINEGEQDYMKSSNYSLFFGGLPERIGSSARQQWHIWNQTSFE
GCVKELTINSDPPDLERVKQKNEIYIGDESQCQESNSIVDVCRNNPCQHGKCVESADGQS
YECKCKIGFSGPFCDQAPTCQKEIKRDFYFEKSCRSTKKLKMAYCVGSCGEVLCKAQKTK
KRSIKLACNDGSKYTKQIEIIRKCGCTKRTSIV
Download sequence
Identical sequences A0A132AED0
SSCA003128-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]