SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA003188-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA003188-PA
Domain Number 1 Region: 182-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000524
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 265-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 82-153
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000136
Family Fibronectin type I module 0.051
Further Details:      
 
Domain Number 4 Region: 412-482
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000199
Family VWC domain 0.012
Further Details:      
 
Domain Number 5 Region: 356-418
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000827
Family Fibronectin type I module 0.08
Further Details:      
 
Domain Number 6 Region: 149-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000839
Family EGF-like domain of nidogen-1 0.048
Further Details:      
 
Domain Number 7 Region: 229-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000218
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA003188-PA
Sequence length 537
Comment pep supercontig:SscaA1:JXLN01014036:25299:28386:-1 gene:SSCA003188 transcript:SSCA003188-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRRGEIVAKSSGKISCRPANDCEDTVSFNAIDSQMSTAKNNQIDAVIQASPLIPSLKNL
IFAPNSASTNKTTTSLKIIKSKKCFYNKKLYDEGETYEKWINKNSPNRKCYECVCQSRSM
RCKEKQCPKLDCPQEKWIQPDDRCCMICETDFCALGHRCHHNAECRNLATNYTCHCRPGF
IGDGHTCADIDECSSIETNKCINSMCVNKPGSYECHCRSGFRPSPQNPFECVAICKDSCL
NGGQCTEPNKCSCRKGYYGHRCEEDIDECAMSLHQCPKNSRCINKPGWYHCECQQGFEDK
RLDINECLDPLLNTCPSHSKCFNFEGGYRCECDHFVNASSSSLLNGNEYALINGQCPQTC
IFNGMERRHGDHWLLDPSKDQCQQCQCSNGVVQCHRKHCDCSNHFDSLDSICCSQCQQNQ
KVCYHQKDHRIMLNGQRWSFECETCECINGEIDCWNECPEINCLNPIRVPGDCCLRCQDD
PCQIDSKNSNSINNTGFSGCLHQNRHYRSGDFIRLNGIASKDKCTSCLCQICHKELC
Download sequence
Identical sequences A0A132AFK9
SSCA003188-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]