SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA003224-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA003224-PA
Domain Number 1 Region: 334-463
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 502-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 3 Region: 254-377
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000377
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 572-648
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000144
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 5 Region: 469-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000149
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA003224-PA
Sequence length 811
Comment pep supercontig:SscaA1:JXLN01011788:69482:72049:1 gene:SSCA003224 transcript:SSCA003224-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAPCPPYLCGSNYNSRLRESESTIHEYSVPAPPSVHRRSGYQSFASSASASASASASAS
VSSSFIAPAVVVQSPPPPPPSAPISKYRSQNFVRKSPAKIIEQRNYIQQKTIQQPIIQQK
IEKIVQEPIKQAPIVQQKVERIVQEPIVQQKFEKIVQEPLPIKQAPIVQQKVERIVQEPI
KQAPIVQQKFERIIQEPIKQEPIVQQKVERIIQRPIVERYEQHVEQRPAQIVEQHKSDHY
QAKKQVKSLRITACPEGHFLSEDGTHCKHYECESGLEFSERQLKCVDIDECQQSTACLRD
EQCINTYGSYVCRRVCTQAGYRLNEARNSCEDINECAENLDQCGPQQTCINTPGSYRCEC
SEGYRVEGSQCVDINECLESHDHLCPHDISTCENTPGSYYCRCRKGFEQDHRGRCIDVDE
CKLNNGGCSQRCINKYGSYECHCHDGYKIGSDGHTCVDIDECVEYAQTGICSPQVSTCEN
TPGSYHCRCKLGFRDPDGHGKHCVDIDECQDNTNLCEQKCINTFGSYKCGCDRGYRAVGP
HRCEDIDECYEGDYINDIAFSRFRHDDQSGHPKLCQGGCQNSAGSYRCTCPRGYNLVHNH
HCVDVDECQEFGYCKGDNYTCVNLGGSFRCVEDQCPPGYFKDGIQCKYAQRLVYSEICED
PHEVCDIDRIICYSYAYISFRSKMLKETEHHKVIGDSSGKGSKYEQRIVTKEPGKGHEFF
TFIVPVDPPIVVDFKLRLVSVKSPRPGVRPANRDDFDMRRTKDNEVRLAVLSSLEGPQDI
ELEIEAKMYKNGLQIGKNLAIITVFISEYEF
Download sequence
Identical sequences A0A132A9J9
SSCA003224-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]