SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA003332-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA003332-PA
Domain Number 1 Region: 3112-3303
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-33
Family Laminin G-like module 0.0009
Further Details:      
 
Domain Number 2 Region: 2649-2830
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-23
Family Laminin G-like module 0.0091
Further Details:      
 
Domain Number 3 Region: 2886-3105
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.98e-22
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 4 Region: 2475-2649
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-21
Family Laminin G-like module 0.0077
Further Details:      
 
Domain Number 5 Region: 2289-2448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.66e-19
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 6 Region: 785-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 7 Region: 1589-1643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000128
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 8 Region: 1091-1137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 9 Region: 947-988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 10 Region: 1042-1088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 11 Region: 843-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family Laminin-type module 0.0093
Further Details:      
 
Domain Number 12 Region: 994-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1186-1234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 367-423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000254
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 15 Region: 895-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 16 Region: 1535-1583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 17 Region: 1641-1688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000204
Family Laminin-type module 0.009
Further Details:      
 
Domain Number 18 Region: 1139-1184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000262
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 19 Region: 299-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA003332-PA
Sequence length 3311
Comment pep supercontig:SscaA1:JXLN01011789:1587:12421:-1 gene:SSCA003332 transcript:SSCA003332-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MICPFDDMISNVMDSNANASDATVRYFFFNEIVFNRFFCLTFFILIKEATKGLYPNVINL
ATDAIISVNATCGETGPEYYCRLVSHTHNSTDCDVCDASNPDFSKRHPIKNAIDGTESWW
QSPSLKNGKRYEWVTININLRQVYEIAYVIIKSSISPLPLNWILERSIDGITYYPWQYFA
QSDTECWEKYRVRPSIGKLRYRTDDEVICTSMYAKNNAIGNEEIDVSLINGRPGAETPEG
ISPTLREFIRAQHIRIRMQKMRTLKGSLLYDSKDLDKSDSSLTNRLYYSIKDISIGGSCT
CNGHADECQNPEPSTGSASRGLVSYQLPKCFCQHNTCGRSCETCCPLFNQKKWRAGTKRD
GSPCEECQCYGHADECYYDSTVADKKLSINKHGVYEGGGVCVRCKHHTTGYNCEQCEDGY
YRPEDVSIESEKPCLRCQCTGPGMNKLCVKDDSHIIEGRRAGDCLCREGFEGPKCDRCAQ
GYRNYPRCEQCTCVNAGIVNTNVCDGNCVCKANVVGNRCNKCKEGYYNLAADNPDGCSQC
YCFGATNKCKPSDWGIEVIKSSERWKVTDVPGTFRIDPDVEDTRYEIANDDIPDSAQHLY
FWEAPAAYLGQNLYTYGNSLKYLVKYVIVRGDTSGVYTEEPDVILEGGPDNARFGYRLDR
REEDSDEDELNSTIILPLREQNWFRVDDQGHAIPDSQPSRQDFALLLHDLKRLLIRAKYH
TDQVSGGLYQTDIEKASNSSASIKKAVGTEQCDCPPGYAGLSCEYCEPGYRRVNNILVNG
VCEKCNCNNHAESCDPYTGVCSECLHNTTGPTCGECKPGFYGDATRGKEDDCKPCACPLL
IPSNNFSPTCRLEPTAKYGYVCLECPEGYTGERCELCANGYFGNPLIPGGFCAPCDCGPN
ANTTIEGYCDRLTGQCKYCLENFGGWKCDECLVDHWGNAAIGDCKACNCDLQGSVSSQCD
KVTGQCECKPNYTGVRCDHCAPGYGNIELGCPPCNCNMTGSTDTICDEDSGQCHCKPGVF
GQHCDKCLEGHFGFSNNGCEWCNCNKLGSEGPDCDEFTGQCVCKPFVTGRDCSHCEPGFW
NIASNKGCEPCNCNITGSYSNVCNEITGQCECKPGVGGLHCDQCLPGYYGFGPNGCSACE
PCTAPGHICDPKTGKCVCPPNTAGPTCNDCAPGTWGFDVLTGCQTCDCNLQGSVSNECNH
KTGECVCLDGFEGRHCEKCKFGYYRFPNCRRCDCHEPGTDPSACKENGLCQCDETGQCPC
KQNVAGRRCDVCKENAFGLSSENPLGCFQCFCFGKSEQCDQSKRVWTEHNFPQREAYFVI
GTTEIRSILGFKTIPSDTNSVGVANFGELQQLFYWTMPQEMLNDQVITYNGFLRFRIYSR
GGGKLSDALRKRYPLVALQGNHRIILYHYGPDQISQTGLYRVKLHESEWTLADNPEYPVT
RDVLMVALQKLQNILVRSSELTEANFVRISDISVEKATLGGFSSKLATGVEECRCPPQYT
ESSCQDPNIGYCRKRKPNYLDSKDILDLVGWAEPCQCYNYSRICDKETCECINCEGFTAG
PYCNLCMRGYYGDPTRRIPCRKCACPTLVNSFSETCELLPGSNSEYVCTDCQVGYTGRHC
EQCADGYWGDPMAPDGKCVPCNCSPIGSISNICDKKTGQCPCKEGITGHDCGNCPPRHVV
TETGCLNCDDDCTGKLLDDVEFLESILQEANLTDVDSLPWTRLMYLTKKFNNTMNRMNRF
KDRVLNGKEMTRNFTVDFDLETLADLLNLQARDLARKAPIEALKARDAVDRAQDIKDRIA
DLWEMIQSIINQLKRHGIDSTDPIGSSADRMFEEAIKILQELRMTDFSPDSRKAEIELKK
AMYLLERVSQLLTERGDTRPMHDQINKLLRLLNEIYDLINRRIYPETREAQRIINMIRPM
LRDILNARDDAVNNADATRTALDEARDLLALIHRDLFDTKIKFTNVADLVAQLNSLMNEI
EKRRSILARLNPEYEEKYVKPCEEHAAELMRRVNELGRLFNQTKDQAQFPLQAANVYDTI
VQALTEAEAAVANARAAAEKAFREANQDSDASLLQQAIDARRRSEELLQEASNLNKRLRD
FQYELAQKQRMLAEIEAMIDSARQDLEWINQSLDQLPKGLGNEVRAIIDRLQSLLDNLAN
SHKRLDDVTQRIYSLEEEFKKLSSGPKADLDEIKRDITQSLLMLKRLKEEIVKIESKGPG
LTRHQQQFDLNLDELKAKIKLARQKAASIRISLGADREGVCIRTYEPDIEPSFTNNIVMY
YAIKHEHIRDSLLMYLGSRNVQSYNNDFMALEMVNRQIRFIWSTGNDERMITHPLMIMTN
DALLSKDSNWYKIEVKRYGSTANLSVLSVPGARFQDPLEMSVTSNSESKRMNLDRNSYFY
VGGLPPDLSNVPRQLQSRSFAGCLFEMYLDGKRVGLWNFTSTIGCDGCMEGATEPIDPNM
YTFFDEFAYGKTRQISNYNKNQYLVSMHFRTFDEDALLFFTSNPRTKDYVAIFLKDGRVH
FECHFGAGPGRQGTSQLLVTDEKLNTGQWVNLRAERENEYAVLEFVVDSNKRTYEKKLQT
NLRSNELDLADADVYFGGVTPNFTLISSIDYPNVVFKSFVGCFNSPQIDTTSINFQRIQS
FGIEPGCLEKPIRVASFFGDGYLELDGQPLNEHTEFSFTFKTPRKFGTLLLSTFEGQPRT
YDRKDDHYYFFYIFNGTLEVRLNGGGGVSTYRFDNINVSDGNYHTVTCIKDSRRFRILID
DEQESTQIRLAKSRIIEAPTKGGLFIGGAPPGYTAINKGYSTNFYGVIRDIVFDSKLISF
NNPVSFKGVGIGHEGSFEMEHPEEQLNYHHQQVVGPPMISSFRPNLFTSDRMVAMPAENY
DYHFGCASTKTSMQMSIESDAMRFGDHLSDSDDFISLETTDNTFYGDFGLTFSFRTFYPN
GVLFTLARNGHHHNHPPHHHQSRSNNIIRPVFVVALVDGILVLRMKMSEKYRFELHSSIE
RPLNDGQWHYVAVGRTKLSLWLNVDHKDMVENNNPKRRLALKKITAFIGGLPENIDQNNG
GVNVEFDPIVSRAAGGAFLPTTEPFKGCLKHFYLNERHVDFKRMHQSDDRKCYSEIEKGV
YFNGNNSWATYDEMFNIGLKADISFEFKTTKHQGVLFSMSNGTNEVPSLSIELADEGKIV
ASVDLGLGPFRAQKKFKNKFELCDGHWHTVKVQYTKNSISLKIDRHDVVYGLIEHSFDDR
SLEPFTEAPLYIGGLPQGAPSGSLFSRKSFHGCMRNIEINDRRKDWLSDIKLFNNIDRNA
CPASIHSTRSI
Download sequence
Identical sequences A0A132AB42
SSCA003332-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]