SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA003725-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA003725-PA
Domain Number 1 Region: 290-542
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-29
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 2 Region: 615-853
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-16
Family YWTD domain 0.0018
Further Details:      
 
Domain Number 3 Region: 124-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 15-50
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 76-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 235-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000147
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 7 Region: 567-607,884-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000173
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 167-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000759
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA003725-PA
Sequence length 1045
Comment pep supercontig:SscaA1:JXLN01011389:4385:7614:-1 gene:SSCA003725 transcript:SSCA003725-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRKLISPILILFLLLVNRANFFDCGNGKCIAGFFRCDGDNDCGNNRDELTGCFHDDSSS
FLSSTGTDSKQTGKSTSNCPDDSFDCGDEMQNCIPKRWVCDGIAECLNESDERNCTTAED
DCGDDFRCNNRECISKTWRCDGIFDCADQSDEKNCTQFQKVSFCDREHNKFQCMGNKCID
LNLVCNDQKDCPHGDDEGSICHVKKCDAKQCEHFCMIDNETNKPSCYCRPGYKLINQKQC
TDYDECAENKIANYCDHICINTDGHYRCDCHQGYDLVNNSTCKAKTQSPILFFSTGLDIH
GYDLRAQTMFPAIKSTNPSETIVTVDVLASEKKLFYSIFKNESYSSVFSISFNSIDNIAS
SSSFINQEKRLLFHDSQSQIEGLSVDWLANHIYLTEFNKNRIIVCSTETLICATLMNYLP
SPRGILVLPTKAMLFWTQWGEQNGIFSAKMDGSDATKMFGDIEWPNDLVFDEETNRLYWC
EGKNGLIEYYDFDIEVRQTVFKDKLRQPYSLFVFENLLYWTDWTYQQLIKCGKISCHNHE
TIFRPILNKGRGLYGISMMHPLLQRSSSAINPCRNHPCSHLCLIKTNNSFSCYCPDHTYL
DNDQRTCVSKQGHSFLIVSTGFKLFKYFPDSITNPFEQISLKIAFSIHDLAYNHHREELY
LYDQFKDRIVMVDLKKGLSNHLKVLIDYDLEGVFGLSYDINTDNIYWVDIIKGSLEVASV
NNSHRAIINSKLEQPISMTIDAPTKTIYVGLKTKHAQIVALGMDGTFLRNVLKTELGLPM
TMTTFFDELIWGDPIIQKIDFITLKNHFNLMDSYQPKRFIQTHVGTVQSLVMIDSGIYWT
NADSPKLYRASLNSSVKSIDWQRIPDKDFDNDNLKIISGLEQKQIYDYCNRNSSCPHLCL
IGNYGPVCRCSLGYETKDGGKTCIRNRSMLQKKPIIHILSLDNIFDFIFSKQKDQLSDTW
VHDENEQNRSDSSSINDDSPPKIDNIQEQQQNEKQNETDFNSLIIEKMTQSKFDGSESSS
SRASLFFWLIFILISLILILLSIKL
Download sequence
Identical sequences A0A132A8J7
SSCA003725-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]