SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA003759-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA003759-PA
Domain Number 1 Region: 5-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA003759-PA
Sequence length 164
Comment pep supercontig:SscaA1:JXLN01011644:7138:7766:1 gene:SSCA003759 transcript:SSCA003759-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLDDYCLGNRCHNQAQCFVDFGSLERYRCKCPKGFTGQFCDRIDFCARPITSNNQTEAL
EICAPFKCINLHRCEPIPKEIYRNCPQKKIWRDGICRCDQDAGYTRDPILGECVLRDPCS
YSNQCGSDARCYASFLGVQNHTDHVCLCKERFAKDSVSGRLHFS
Download sequence
Identical sequences A0A132A973
SSCA003759-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]