SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA004031-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA004031-PA
Domain Number 1 Region: 340-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 2 Region: 1-32
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000381
Family I set domains 0.053
Further Details:      
 
Domain Number 3 Region: 299-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000628
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA004031-PA
Sequence length 418
Comment pep supercontig:SscaA1:JXLN01012231:16523:17814:-1 gene:SSCA004031 transcript:SSCA004031-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIHNVSKEDQGIYSCEAINSKESEISINKTVLIIIFETYNTLFRIAKNFLCKPPMFNDE
AQNYDECFECFCFDHTDTCYSSSLSPTSITIDDPKQLTIAAIVRSLSTRERIEDVSEQFP
PNQRSIRLNSQTKTFTIDSRIASPNTPENVHFYWRLPENFLHNKLLSYGSYLKYTQWDYQ
PSSIRNLIEDNMPNIIIRGENISLFHFKSLQNSFPSDENQISVRFWTDQWQRSFDDPHLD
DHLNRSQTYHLDRRDILRVLRNIKEILIKATYDAFIYESSIANIELESGLITDHPDRYRS
AFVEQCVCPQGYSGTSCEDCAPNYWRQSTTGECVPIETICHCNGYSNECDRFTGRCLNCQ
NHTQGFHCEQCDRGFYPNPTQSNDFFDDNDDDEKQSFHCLKCPCGSNTDHHHNHQDPR
Download sequence
Identical sequences A0A132ACF0
SSCA004031-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]