SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA004402-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA004402-PA
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-48
Family Astacin 0.00025
Further Details:      
 
Domain Number 2 Region: 603-712
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-39
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 3 Region: 287-396
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-38
Family Spermadhesin, CUB domain 0.00012
Further Details:      
 
Domain Number 4 Region: 442-553
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-32
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 5 Region: 735-828
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-28
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 6 Region: 164-288
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-26
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 7 Region: 553-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000234
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 8 Region: 395-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000519
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA004402-PA
Sequence length 882
Comment pep supercontig:SscaA1:JXLN01015550:9515:12892:1 gene:SSCA004402 transcript:SSCA004402-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHWENYTCVKFVERTIEHPNYIIFTERPCGCCSYVGKRGNGPQAISIGKNCDKFGIVVH
ELGHVVGFWHEHTRPDRDENVQIVTENIMPGIEYNFNKLTEDEVNSLGIKYDFDSIMHYS
RNTFSKSISLDTILPKDDPANTVRPEIGQRLRLSQGDIAQTKLLYRCPKCGHTIQNTNGM
ISSPNYPQSSPPAEGEYCEWRITGTHGERIIINITDIDIYETNNCENGYLEIRDGYWFKS
PLIGKYCGQGEIQTAMMSKGHRLLISYMATPNQHNHRGFNMTYEVICGGDIVAEQGYLQS
PNYPEEYRSNKECVWRITVPEGFQVALKFQSFEIENHDNCAYDYLEIRDGKSEDSTILGK
FCGNKIPNEIRGSSNYLFVKFISDSSVNKAGFSATFIKEINECLGSNHGCEQECINTFGG
YHCECRIGYELHSDRKKCENACGGIIESSNGTISSPSFPDLYPPNKNCIWEIVAEEGFRI
LLNFTFFDLEGNNQDCEYDKLDVKSKVNNHYSTHGLFCGSRLPPIITSQGHNIRLEFSSD
NSVQRGGFNLHYFTDRDECAINNGGCQHICRNTIGSYVCECNSGYVLHENKHTCKEGSCS
YQITSSNAEIISPQYPDGYPSKKDCTWFFLATLGHRVKLVFEDFDLEPQQECSYDYVIIY
DGITTNKSVLGRFCGSKSPHPIISTTNKVLMKFKTDASVQKKGFKAHYYTVCGGRLFAKN
SIEHLYSHFKFGDANYEKKEDCDWHIVTNIGMKIYLKFITFELEHEANCSYDFVEIFDGD
DDNSPSLGKFCGNQMPTDMISSSESILIRFRTDDSIHNKGFTLIYSAVETIENELINAID
SNKSIEKSIRKTQQSFLNEKNNNYLSKYLSINEDQQDDFLLP
Download sequence
Identical sequences A0A132AI26
SSCA004402-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]