SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA004407-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA004407-PA
Domain Number 1 Region: 141-331
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.96e-32
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 2 Region: 2-103
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.25e-29
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00035
Further Details:      
 
Domain Number 3 Region: 329-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000148
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 4 Region: 104-148
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000217
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0025
Further Details:      
 
Domain Number 5 Region: 490-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000041
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA004407-PA
Sequence length 744
Comment pep supercontig:SscaA1:JXLN01013891:31337:34491:1 gene:SSCA004407 transcript:SSCA004407-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSWTAAYGNLKQYLIFNFEERFVVNSIATQGHPNSDSFVSAFHISSSDDGHFWTSLFQG
NTDGNSVVINHFDPPIIAQFIRINPTRWRDRISMRIQLYGCDYRNTDGNSVVINHFDPPI
IAQFIRINPTRWRDRISMRIQLYGCDYQAISLNFDGNSYIKMNLDIRPIDSSLDDVFRFR
FRTNEAFGNILYGTGVQGDLLALQIIQNKLLLSLDLGENQIESISAGSLLDDNLWHDVFI
SRQGRDLTFSVDRVVVKHRLRSEFNRLDLNNDLFIGGLPGHQSDFIHTRKNFTGCIENLS
FNATNIASEIQNDRKNFVYKTFGNIHYSCQFQPVIPITFNTRESHINVLGNLNNHLNVSL
DFRTFNDYGLLIHHQFSIKGFFAIYLKNSKLTLKIQGIDPISNEETPQVVLDPFEKKLND
GSWHNVQLSLQRNKILLYLDQIPXSPYRGLIGCMRWIYIENRFINPEMISPENIHKVQES
DISIKSCQMIDRCHPNPCEHGGVCKQNHLDFVCDCGDRGYLGAVCHVPRHPFSCTAFIND
NPNTKREDIKIDVDGSGPLEPFWVTCLQTAENTIETVIHHQNEAAQKVQGFAQPGSYMQD
IKYDAPLEQIVHLVNRSDACRQKLRYECKNARLLNTPSPLTSEFFPFTWWVSRDNQKMDY
WAGGLPGTRKCQCGLYGNCYDPKKWCNCDANTNEELSDEGEIRQLEYLPVRQLRVGDTGF
SNQDRYGRFTLGPLICEGDQLFND
Download sequence
Identical sequences A0A132AFA8
SSCA004407-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]