SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA004641-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA004641-PA
Domain Number 1 Region: 76-230,328-375,414-602
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.22e-32
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 
Domain Number 2 Region: 751-996
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-22
Family YWTD domain 0.0011
Further Details:      
 
Domain Number 3 Region: 1154-1192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 1198-1235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 1291-1328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1240-1280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1382-1419
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000012
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 8 Region: 1109-1147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000101
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 1338-1374
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA004641-PA
Sequence length 1435
Comment pep supercontig:SscaA1:JXLN01006843:2740:7267:-1 gene:SSCA004641 transcript:SSCA004641-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTTIVWFFKALLLPIIFITPSLSIEDNFFVINRPSHSHRSFRSVSDIEHSRELNFEKND
SIVTLFNNDEINDVSVVHLNDQHEQLTVHWAGKNSPVVICLAKNRLYSKNRSSAVYLSND
YGQTYHRIKNFRQKNGFDAIIETFYISPILNSFYIFVDKINRLLFITTDYGRNFQKIELN
FSPNSLKLHPIVSERILMQASPTASNHGAALYLSENYGMFWRKLQDNIGYYSWCDDGRKI
LVQRIEPNGYSSLILLIPSLNSSLQTHSITDEPLLIKKVEMNGKYIFASVCNQSSSVAAN
LCDSVHLWISNNFHPLKPIRRFTNESLINFLVADVSENIVLLCVTKRNNQTDLYKSNDFR
NFHLSTENIVFFNYNLSKNLPGVNRQTMKDLEFADISHVAEIRGTYIVSKWRNNERKSIS
DMITMITFDYGNHWHLLRAPGQDALGRLIDCRFENNCSLHLSQRFLSINSNSKPILSGKS
SVGFIMATGILGNSMKGKQNIYLSVDSGNTWRQVLSGNYLYAFGDFGAIIVAIEHHSKGR
STNELYYSIDDGKSFALFKFAREKILVFGLLNEPGEKNAIFTIFGSKELQHDWIVIQVNL
TSRFERQCRSPDDYVEWSPHDYESNCLLGSTEIFKRRISSSKCYNGINFERPVSKINCPC
KHTDYECDDGYVRASKTMGLRCVANDLQIIQENANRSMLSYCSHFESFKKSQGYRKLIGN
TCEGGEEKFYSKKSIPCPLKFESDFLLMISSKEIAVYDPNVIDRSSYRYRLLKSSYISSR
PISADYELEHNSLIWIDDDSRQILRYTFDGGDFKPEIIMKSIDDDYFGFDEDFENPIETI
ALNQINNHLYFIRKNRSKIELIDINKNNEYRFRRTIMTKPIIDEPNGLAIDPIACFLFVS
DSGNSPLILRSELDGQNVQILFNSNIIQKPIGLSIDPRYKLIFWADSSLNYIASSMYDGK
NLKYHGKDRKISPSFVFVAYNEQILYYDWKHNRIAEMKLIYADFLGKTNVCNLNTTCSHL
CIAKPFNSYRCLCPVGYRIDLMPDGNEKCSCNGTASNDYDECKNSSSYSNRSSKKKSKCS
DEHCHPIECDQGEKMCSENSEIEALDEHHQCGPRQFRCRSSGLCIQDFYICDHEMECDDG
SDEDYQLCQSFFPKCNETDQFQCRNYRCIYRKKVCDFVDDCLDGSDEINCLYNSTTKNNT
CQSNEFRCDNDDCIPKSQRCDGKPHCLDKSDEFDCNDPTKCSENEFSCSDNICLDNIFVC
DHEDDCLDGLDEKNCNYTDLILNPSSIENSTISCSDRMFQCESKFCIPQEWVCDESDDCP
DFSDERYCSGMKSSDNSTCGYRKFFCSRSEECIPIQYRCDGDQDCRWNEDETNCESDEFF
QYNCTDDQFECLGNSLCIEIDLVCNGKIDCPDYSDEQGCLNSKIETSSICLGKFI
Download sequence
Identical sequences A0A131ZZ90
SSCA004641-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]