SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA005707-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA005707-PA
Domain Number 1 Region: 996-1086
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-18
Family I set domains 0.0073
Further Details:      
 
Domain Number 2 Region: 1194-1279
Classification Level Classification E-value
Superfamily Immunoglobulin 9.85e-16
Family I set domains 0.0084
Further Details:      
 
Domain Number 3 Region: 1100-1187
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000298
Family I set domains 0.016
Further Details:      
 
Domain Number 4 Region: 1299-1374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000038
Family I set domains 0.0096
Further Details:      
 
Domain Number 5 Region: 1488-1557
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000649
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 789-840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 7 Region: 907-990
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000771
Family I set domains 0.022
Further Details:      
 
Domain Number 8 Region: 362-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000809
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 9 Region: 1378-1480
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000957
Family I set domains 0.041
Further Details:      
 
Domain Number 10 Region: 846-895
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 11 Region: 302-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family Laminin-type module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA005707-PA
Sequence length 1610
Comment pep supercontig:SscaA1:JXLN01012231:9894:15084:-1 gene:SSCA005707 transcript:SSCA005707-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWIVTKSLIFYSFELREAFSLTCNSFGGHWNEKTSQCDCKRLVYGDHCDKCMDGSFHLN
HWSPDGCIECFCSGQTKICNIASNLYRNPIILNLEQQRDAIVLSDLDEFLIDSDPKQSKK
EFNFTYNGRELFFKNFSHETDQLYWRLPLNFLGNKITSYGGHLNFTFRFNGNFYHHFHRS
INHLDDFQHRNDDSQQSYKKNPDAILVGNNMTLIHFHRLVLRPLVSNTIEIALLENEWII
LYRQAKQKATREQLMTVLSNLEAIYLLASVTNDINSISLIKVTLDASVEMFPAKYESSLS
LIRTSTIERCHCPPGYSGTSCERCAPGFYMIKEINPSFPWSSSNLDRNSSSLLPFRFRCE
PCSCNGHSIECDPSNGHCSNCQHHTTGPDCDQCIDGYEGDPTKQTDHDCWPKNDFDQRNC
YCNLNGTKDIDNCLANTNENQNGQCQCKENVEGDRCDRCLEGHFHLSKENPMGCLQCFCH
GKTNQCKSKNHLYWSRIEANFSNFYENKFELSTRFQTISYSDRILYNFTNNEAYFYSLFW
LQENTNNDDVEENIDFEFKDNNNNLEDLREGYRMSKEKSYKNHHETLYWFLPRQFLGNRL
ASYGGRMHFVRRYKIQNDYGDFINDADVFILGNGLMLQFISSTRFPPNIDQPFHIALNAE
GELWQKIDHKTQLTGLASRADFLRVLSNIDVIAIRATFHTQMKESFLKSVVLDTAVEFDA
VSDRNHNAHHHQHRQTYNNKRAMNSSLIQAFEVEQCECPMGYEGLSCEQCQPSYVKKSTS
DGHFTCEPCDCHHHSNRCDPSTGKCLDCQDNTFGDYCEFCMDGFFGNATEAKDACHPCPC
PTTAAYNNFSPTCKLDTDGLPTCTQCAKNYTGRNCEICNIGYARNESMPHSFCESIQSAQ
TIKVSIEGPKVKHVSAGSTLVLKCNGSSQISQYFNLDWIKLDGQLPEDHTEASGILTIPN
IRSEHGGTYVCTGFDLESVATARTIVMVKSSMQKFAPKVHIEPKYLEVHSGSSVSFRCVA
DGFPKPHLTWKTVQNEMIINPSATFDPQSGVFHIRNVQKNDEAEYECYATNSAGSDSAKT
FLFVHDYDKYAYVHVNGIVPTARITPSSLNSKRGAKTKLVCNVTGKPNPSIRWIFLGNEP
DGRLPNNSRILGDTLSLINLDVYNNGIYTCIASNSYGTAEAQARLHIDHNHKIKPFVSAE
PTRQTVVQGKSGHLRCAVSGHPKPTIKWIKLHDHIDPNRYEIRDDKLIIKQMSLKDRGVF
VCIAENSMGKSNATVYVEIERREIPSIKIDRTDPIGSQKESKTYLKCRIIAGIPEPVIEW
RRRDGSSFTSNVEINGGLLQFNRIDVQDEGVYVCSAENVAGRATAQITLSSSNVPRVKIL
QNSPFRARRNDLVKFDCKSQSSSSSPSFSSSQNKIDWHKMRTNSVSEPIYEQPRHSIKII
NEDHVALEIDSVDIEDSGIYVCSIDSLKGSSEERIQLIVEPNIDSVPDVLVEEKVVTVSI
GSRAELRCLIRGTKRKISIKWIRAENASLPEKAKVENGTLTIDNVKPSDSGDYFCLGYLD
DQTKVLFKNRARLAVVGKLIESAVIVILLSSLIIILLALLSARYLGKSFA
Download sequence
Identical sequences A0A132AAZ1
SSCA005707-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]