SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA006181-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA006181-PA
Domain Number 1 Region: 205-389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-30
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 63-121
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000011
Family Ovomucoid domain III-like 0.021
Further Details:      
 
Domain Number 3 Region: 6-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000172
Family EGF-type module 0.094
Further Details:      
 
Domain Number 4 Region: 382-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA006181-PA
Sequence length 449
Comment pep supercontig:SscaA1:JXLN01011186:137:1667:-1 gene:SSCA006181 transcript:SSCA006181-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSRTDCEQMTGRCVCKQGFQGMKCDICSDKNADETEKCPVNNATTVTNQQAISNSCQD
SEQCRFGSVCIDSKCVCDFKCPYSDQIVCGSDGQIHESRCHMEFESCKSSKEIVVLPKSQ
CSTTTIFDNHFSIDDSDDTATTSPVRRSTYYLDYERSKQSIVPDRSNLNSEGILLNTSPT
IPTINGDDNDGRDDDLTLLDSGSRSAHFNGNSLIEMETLKAHEKIYISLEMIPFSSDGII
LYNGQTNTGEGDYIALMIKNSIIEFKFNLGSGSVIFKGPRPVKLGSKISIEINRRFSQAS
LTINNEQIIGENRGPHRLLDLGSNFYLGGLPSSNFKIINDVLQVKKNFTGCIHSMIINQE
RIFLFNNFFKQSLINVDNCDKKACAKSFCHNNGYCEHLKDIENQIDSIHCVCSRKYQGDR
CESKICTGHRCTFCQYDPNLCNQCQFLSN
Download sequence
Identical sequences A0A132A7Q2
SSCA006181-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]