SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA006508-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA006508-PA
Domain Number 1 Region: 12-105
Classification Level Classification E-value
Superfamily Immunoglobulin 7.34e-17
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA006508-PA
Sequence length 108
Comment pep supercontig:SscaA1:JXLN01003115:10162:10537:1 gene:SSCA006508 transcript:SSCA006508-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHICFPFDDTVAPKIAKFQYEIVQPKGSIFMLNCQTFQGTLPIRYQWFKNGLTIDESLM
KLHRIQIETKNHFSLLTIADINFDDSGNYSCLASNEIDSDSQWSLLEH
Download sequence
Identical sequences A0A131ZW27
SSCA006508-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]