SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA006967-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA006967-PA
Domain Number 1 Region: 303-439
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000816
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 275-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000577
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 109-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000536
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 158-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000175
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 194-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 6 Region: 232-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 7 Region: 70-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA006967-PA
Sequence length 445
Comment pep supercontig:SscaA1:JXLN01013166:2503:3976:1 gene:SSCA006967 transcript:SSCA006967-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRQSPHQILHIVLFTILIVIVHFCIPIANQRLNRRQTKPNLSYSIGSNANRYGSSSNS
NTNLAIYRPGRCYPNVCLNDGQCIVNPNTLKSYCRCPPRFVGSSCEYQNPCFGNNRCFNG
GTCQPIISPNQPPSFKCLCPLGFSASMCEVEVPNICQRKRPCRNNGRCVLHTDLEHYQCN
CISGWRGERCEERDNCASSPCKNNALCISNTNGTGFTCECQNGFRGNTCAEDINECLELG
DDLACNQKGQCINVPGSYVCNCEAGYTGQRCETVYIPCQSDNPCQNGGDCIADHLSKTYQ
CSCPVGFTGRNCEINIDDCGGHLCQNGGTCLDDVNTYTCICPSNFTGPYCSQDVDECSLQ
PQPCQNGATCANTIGGFNCICVNGWTGQTCSENIDDCANAPCFNGATCHDRVGSYYCQCP
PGKTGLLCHLDDACASNPCHSKLTE
Download sequence
Identical sequences A0A132ADR6
SSCA006967-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]