SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA007037-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA007037-PA
Domain Number 1 Region: 290-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000258
Family EGF-type module 0.019
Further Details:      
 
Domain Number 2 Region: 260-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000569
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA007037-PA
Sequence length 348
Comment pep supercontig:SscaA1:JXLN01011010:60943:62305:1 gene:SSCA007037 transcript:SSCA007037-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFRRICYIFVCFVCSSIIEAIDVNYHYENHQNNKDGFGGSTGGDMSLWIDEMQVKQFFN
GFPMKIHAILDGVVLPYVLDPNFEKYLPVIPSQVTSVNFTWKSGENRNYYYDFDQLQSFD
MNILKKPILSIESKGLVPKKPKIFQVLIPCVGNMSGVASFTLGLRIIDIETNQHLAGTPI
RLKLQKQCTYHGPDPECDKKCGNGKCNNEKICVCPTGFLGKYCESALCYPQCQNGGTCIA
PGVCACSPGFQGLHCEGGICSQKCLNGGKCIQKDSCLCRRGYYGPRCEYSKCSIPCLNSG
KCVGVNRCRCRKGFTGFQCQTKTNRSHCSSSSSKHPRNRKRKSKKKFV
Download sequence
Identical sequences A0A132A6Q7
SSCA007037-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]