SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA007325-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA007325-PA
Domain Number 1 Region: 2158-2361
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-33
Family Laminin G-like module 0.0079
Further Details:      
 
Domain Number 2 Region: 1917-2129
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-33
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 3 Region: 1398-1523
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-29
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 560-695
Classification Level Classification E-value
Superfamily Cadherin-like 3.5e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 239-347
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-25
Family Cadherin 0.0018
Further Details:      
 
Domain Number 6 Region: 898-1017
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-24
Family Cadherin 0.0034
Further Details:      
 
Domain Number 7 Region: 1169-1299
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-24
Family Cadherin 0.00036
Further Details:      
 
Domain Number 8 Region: 455-564
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-22
Family Cadherin 0.00085
Further Details:      
 
Domain Number 9 Region: 1059-1181
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-19
Family Cadherin 0.0007
Further Details:      
 
Domain Number 10 Region: 346-462
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-17
Family Cadherin 0.0033
Further Details:      
 
Domain Number 11 Region: 787-882
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-17
Family Cadherin 0.0011
Further Details:      
 
Domain Number 12 Region: 141-251
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-16
Family Cadherin 0.0034
Further Details:      
 
Domain Number 13 Region: 1508-1624
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000117
Family Cadherin 0.0018
Further Details:      
 
Domain Number 14 Region: 1286-1402
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000419
Family Cadherin 0.0042
Further Details:      
 
Domain Number 15 Region: 673-786
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000895
Family Cadherin 0.0066
Further Details:      
 
Domain Number 16 Region: 25-121
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000275
Family Cadherin 0.0052
Further Details:      
 
Domain Number 17 Region: 2403-2443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000156
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 1625-1722
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000314
Family Cadherin 0.012
Further Details:      
 
Domain Number 19 Region: 1891-1930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000019
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA007325-PA
Sequence length 2472
Comment pep supercontig:SscaA1:JXLN01000003:151626:160795:-1 gene:SSCA007325 transcript:SSCA007325-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARIVFSYHYLNDDKDDIVRQRVIIHIKDVNDEKPYFINRPLPMQAVVQLNAKPGESVYK
LQARDPDTDHNIHYFLVRDRTGGRFEVDERTGEVRVKSYEPFMLDKEYVIYVKAEDHNGP
TGDRTFQSTEEARLSIMGGKRAPQFYMPHYETTIPENQRKDSDIIEVKAKSFAERQIRYT
LKTQGSAGSGTFNIEPTSGIVKLAKELDYEELRQPKTYNLIVTATEDSGGFSTSVELTIK
VTDVNDNAPRFELPDYQAHNIDEDVDIGFSILQVSATDQDIGKNAEIVYTVDRDDFVIDS
KGVIRSNKRLDADMNNTYVFTVRATDKGDPPLTGTATVRVYTENKNDEAPKFSQDVYTPN
VDENAGPDTLVTTVVASDKDGDGILFGFVGGGTTSGMFTIEERTGVIRLTSGNIELDKDK
YELNVTARDDGSCCRGGARTIHTSTALVVVFITDVNDNKPVFDDCLSYEPKVEEGSPSGT
PVITVKATDQDKGHNGQVRYSIVQQPNQKGTKFVVDEITGEVKTNKVFDREGDDGRFVSV
TVKATDRGSPPLEGVCSFKVEITDINDNPPLFDRQEYKEYVRQDTALGTNILRVSASDED
ADMNGIITYNLTALDRHSDLSYFNINHESGWISLARPLEGEHYSMRAIATDNGRPQHRAT
VDISIDVVDRANNPPIWDKPEYGPIRIPENVPIGHKVISIKARSGIPDNPTVFYTLMKGG
TEQTNKKDTFYVIQSPGEGDEIWADICVNQPLDYERINQYNLTVRVQNNGVQQLGSEATV
HIYLMDVNDEIPLFIEKEQETVLEGMPPGTKVTQVEAIDKDGTPPFNKVYYSIVSKGSDN
NPPFKIDRETGEIFTNMEFDREEKQAYAILVKAEDGAPSARPNMKINEPNYVTKYIRIAI
GDKNDNPPYFDQALYDAEVNEDEDIHHTVITVTAKDKDESSKIRYEITRGNHGGAFAVKN
ETGAIYVAGPLDYESRKEYKLRLVASDNLNENYTHVVIHINDVNDNPPIFDRPSYETQIT
EEDDRMLPKRVLQYNLTLVASDTLHENSTQVRLFIKDINDLPPKFDQSSYEATILEEDDQ
DLPKMILKVTATDGDRDRPQSIVYFLTGQGIDDKNPRNSKFSINSTTGDIFVLKPLDRDL
PTGRSQWRFTVFAEDEGGNGLVGYADVLVNLRDINDNAPFFPQSRYEGNVTENGTADMTV
MTMTATDYDDPNEGSNARLKYAIEQNPVNERGELIFKIDEDTGTISTLVCCLDREQNPEY
VIKVVATDGGGLKGTGSATIKIRDINDMPPEFTKKEWSVEVDETDGEMLPETPILVVSVN
DQDLLETNRFSYRVLENSFGADKFTMVTNSDGTGSLKVAKPLDYEDLQQRYGFNITIQVS
DSGENSESYHVDYAKVYIRLHDINDNKPEFKETNLDVTVQEDANIGTPLATFVAYDADQG
GRSRVSYAIDRSSDKKRQFTIGQDGVVKTQRMLDREDTPRHHVKILAIDDGIPARTATTT
LTVIVVDVNDNAPRFLKDYRPVIMEHQGPTKVEEILATDDDDRSRNNGPPFTFRLSKDAS
ETIKEFFDVHQDHKGANGDGMAIVTSKKEFDREVQKEYLVPIVIKDSGYPSKSGTSTLTV
IIGDINDNRMYPGSKNIFIYNFRGRTPPTPIGRVHVEDLDDWDLPDKSFIWEGGVAHPLF
ELNTDDGMITMKNVTNGEYFLRFNVHDRKHTQNVPANVTVVVRELPEEAVYNSGSIRVSG
ITAEDFIRVWFPHKQKQEKSKYEKFKDVLARILKVQRENLDVFSVITRSERPPIMDIRFS
AHGSPYLKSVFLDGAVTLNRKVIEHQVGINITMVGIDECLIENYYCESSSCTNVLEIYPQ
PIFVNANRTSFVGVNVGVRPSCTCDARDFEKVERCLSMPPHCLNGGRCTDTSVGALCTCP
RGYNGPRCEMPSRTFHGDGWAWYPPLQFMTRTPSGLLFYNGPMGEPIEGEYKVTDFISLE
LQRGNPRLLIDFGSGTAELTVHPIGDLHDGEWHRIDIFWTKETARILVDNCAGIRFNDDD
LLRVDRSRCENITQIVGFNEFLNVNSPLQVGGVYQKPSSSGISPLLANANYYNLPTKMGF
NGCLRNLIHNSQMYDLGSPGSYSNSEPGCQISEELCKANSVYGRCANGECVASFNSARCI
CEPGWAGPQCDRETISKMFQTNSYIKYAISFDPDPYRNEIQLQFRTRQKNGELFRVASKH
YREYWILEVKDKKLRFRFNLNNLEERELWLPFVSVSDGQWHTVKVQRFGSTASIALDGGG
GRRSNEIIDYEGLHQLLLVDKQNVMAGGFAQIVGPSQYIVDFDYIEGCMADIRLDGRQLP
MENGSENAFVVEARNIITGCPSNNPCEGIHCNHPFECVDLWNLHECRCPLGFSSTGNGKN
CTDLDECYPENPCLNGGTCFNLPEGRGFHCTCLPHFSGQYCNALRIGKELQLSNSALIII
LILGFNFISMWA
Download sequence
Identical sequences A0A131ZSM3
SSCA007325-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]