SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA007820-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA007820-PA
Domain Number 1 Region: 417-654
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-45
Family YWTD domain 0.0000133
Further Details:      
 
Domain Number 2 Region: 54-76,105-330
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-38
Family YWTD domain 0.0000116
Further Details:      
 
Domain Number 3 Region: 741-892,919-1036
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-28
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 4 Region: 10-46,359-412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000392
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 693-733,1060-1093
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000157
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA007820-PA
Sequence length 1233
Comment pep supercontig:SscaA1:JXLN01012099:7666:11787:-1 gene:SSCA007820 transcript:SSCA007820-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSIEAESDPCRASNCSHLCLPNNETYKCLCPFGFSFDDIRTKQKCRSDPDPLLLYTNRD
EIRSINLSNQKLLSTAKFQQSRSDNYSIEDQINGLDLNHQLLPLIDVGFISSIDYDPITL
DLYWTDILHKSISRSRWNGENQQKLFESSLDVPSGIACDWIAKNIYWTDTVRNVIEVSTM
NGSHRAILIWRSLHQPRDLVIDPPNALMFWSQWSNETSSIERSGMDGSARLKLHKNNLTR
PYGLAIDFKAKRLYWTDTKEAKIESSFYDGSDRRALLSNNIRQPFSIVIKDEFVYWTDSF
FHSIRSANKLNGQYDNIVAENLNNLMDFIIFYPKSASSVSVISKINYSIDHRHFRQQQQH
LNQQQNILFNRNPCDRSKCSHLCVLSPTTSSGYRCLCPIGIQLSSDNETCMQDMKKFLLV
TTRTEIKRISLDTEYHFDSRLDLERKLVNAFVLDVHLKSASVFWSDTKRSIIFKAKLGDG
KISRIIDHDIDGVHGIAIDNFADKIYWTDAGTKRIEVASLDGHWRKVLIHKDLDSPRALA
LNPRTGQMVWSDWGSLVRIERADMDGQRRSLIVNSDLGWPNGLTFTYQGQIVWTDSQKHT
IEIVDLNGTNRKILLKDLPSPYGITMIDNYLYWTDWQTKTINRIYMSSNQNLIELSAKME
IFARSLNNLVDVVAIENSWLDSEKSHQSLMIKNICSDSYNLHNCSHLCLLNSSPGYSCQC
PTGVVLQDDRSTCKQKVDKKLIFATDKSLRQISLDNDEWIDIDLLTNKPINLITFDLHYK
SGRLFYVDQNFKQIRSLSFFRSTRVSSESPSFDPVLKTRTKILINDNLKKPSSIVVDQIA
ENLYWSDEERHLIEVSRLDGSSRKILIDLDLNGPRCLEILPSLGLLFFVNYETSPAKKPK
QKIEREQNFLCHFLFNSISSINFKAYLDGSSRFILVETDVGQINGLALDDSSNENYDLST
RLYWTDGYHKRIESITVEGKQRRTVISSGLASPSAVTILDNYVYWYDSFHHVIERANHQT
GLEYQTIIENHKNIVQIKSFSAPKQSKNFSNSNHRLITINQTNLSNPCSINNGDCSHLCL
FRPSGYVCACPLATAIICSTVPGQSVSIDLLNPSNQIEIEERSSSEEYLSPSTNHQSMIN
LTESAHSTTVSSFEVDGLDSDFHFKSDGFENVTTLDHHRDSWCWFSSNNLTLFDCITMHL
HLSNRSLSEIFKSIAVILFIAVIFITIMIFKKK
Download sequence
Identical sequences A0A132AAI2
SSCA007820-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]