SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA007889-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA007889-PA
Domain Number 1 Region: 457-564
Classification Level Classification E-value
Superfamily TIMP-like 6.02e-20
Family Netrin-like domain (NTR/C345C module) 0.069
Further Details:      
 
Domain Number 2 Region: 315-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000223
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 3 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 362-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA007889-PA
Sequence length 569
Comment pep supercontig:SscaA1:JXLN01010456:1359:10699:1 gene:SSCA007889 transcript:SSCA007889-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFFLNKFLQISLIVWACKLRSSLCYHYQSSSSSLSSTLPQFISSQNSVPTDPCYDDSGN
PKRCIPDFVNAAFGKAVEVSSECGYTPTRHCFVSTNDQDHLVRNCELCDQNDHRYSHPAS
YLTDLNNPHNLTCWMSEPFIDQQQNVTVTLRLGKKYELTYISLQFCDTKPDSMAIWKSMD
YGETWHPFQYYSSQCRKVYGRQNRAAITKANEQEPLCADSNSEPIPGSRVAFSTLEGRPS
AYDFDNSPVLQDWVTATDIKIVFNRFVVIDDGGEGSNFDDTILGSSSPTSYDEVNVTNSI
DSVFYAVSDLAVMATHQDGDGQLVCDCKHNTAGRDCEKCKAFYFDQPWARATAQEAIECQ
PCNCNHHARKCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCREACDCHPVGSSGRTC
NITSGQCQCKPGVTGLTCNRCAKGYQQSRSPIQPCITIQANIISRETIGDWIRFTLQIRH
VFKHTSHFRLRKPIEHLWVPESDFECKCPKLKIKHTYLILGTYQKENLHNYRLIANRNSI
VIDWEDEWHDRIKRFQKRQLKGKCKNEYD
Download sequence
Identical sequences A0A132A443
SSCA007889-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]