SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA008181-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA008181-PA
Domain Number 1 Region: 350-556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.36e-42
Family Laminin G-like module 0.00044
Further Details:      
 
Domain Number 2 Region: 135-317
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-36
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 550-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 21-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000716
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA008181-PA
Sequence length 683
Comment pep supercontig:SscaA1:JXLN01001489:7339:10408:-1 gene:SSCA008181 transcript:SSCA008181-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDCKPLSNRFNLCVGECRKTSPCQQLCFDLHDGTFECACNQGYRLDLNGYSCIDEEIHQ
IDNDHRYHQFDPSSSSSSSSLGTIFDKNQNRIESNQNSAESATLPLQYSCNDVECEAGGV
CVDEIKQSDREYRIRCKCPLGRGGQFCEKIIEVKQPRFKSSSYLALPTLRNAFRSLRIYI
EFKPNSYNGLLLYSGQEPNLDGDFIAIILREGFVEFRMDCGMGEGIIRSDLPINLNAWNT
IDIYRDGRNAWMQLNQGRQIFGHSKGLFSRITFRLETFLGGSPNISQISDRIEVNNGFEG
CVRNLKINDRLYDLYNDTIDGIDIEQCRSDICKQITCLNGGYCSVIDTDQNRKQCICPLG
FSGEFCEKQIELSIPQFNGSSHLQFIGLGEQETLQSELLMIIKPNHTDGLFLYNGQKMDR
TGDFISLNLIDGFVEFRFDLGSGAAVIRSPERIAMNEWHTIHASRTGRQGWLRVDDQPIA
MGLSLGGFQQLSLPLNLYIGGVPNLQHIHHNVQANENYHGCIQRLIINNHHLSLLKDVLS
GTNIDNCQHRCQTKPCQNNGYCEPFHHQYHCRCVSNSYFGKHCEKGLLNKANQFNHFGTV
CTHLCIFFLSSFFATLFSLRFRKTSSLFFMKQYETMNDEESEPEPNPMFYGNSFLKYTGQ
YILDQLSGPNTIIHLNLRAFRIN
Download sequence
Identical sequences A0A131ZU59
SSCA008181-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]