SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA008236-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA008236-PA
Domain Number 1 Region: 39-138
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 150-268
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 3 Region: 328-450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000502
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 1073-1218
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000847
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 5 Region: 2558-2596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000559
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 2735-2771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000143
Family EGF-type module 0.03
Further Details:      
 
Domain Number 7 Region: 541-677
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000022
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 5089-5120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000716
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 752-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000356
Family EGF-type module 0.027
Further Details:      
 
Domain Number 10 Region: 2174-2283
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000518
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 11 Region: 445-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000629
Family EGF-type module 0.032
Further Details:      
 
Domain Number 12 Region: 4940-4974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000839
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA008236-PA
Sequence length 5178
Comment pep supercontig:SscaA1:JXLN01008777:119024:140733:-1 gene:SSCA008236 transcript:SSCA008236-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSYYCSCFPGYEGDGFSCKDINECEIPSLAALCGENSECCNLPGHFVCKCRQGYTGNAT
IACTDVNECLEDDVCGRNALCENTPGSHLCQCPNGFEGDPYVECTDIDECLTNPCSSGSV
CINTIGSYQCSCPSGYEPTKNLTDPTKIENCLDIDECLIDGICGHNTQCINIPGSFVCEC
GPGFTGNPKTSCEDIDECSKENHCGPNSKCINKPGSYECICLDGYNGNPIRGCKDIDECL
TNPCGPNAVCINTIGSYQCQCPDKYLARDGQPELGCDRAAVDVTCQTQSDCTRNAICSNG
FCQCNSGYRIEGINCVDVDECETNPFVCGVGSVCTNLEGGYECVCQEGYTKLFNGSPKTP
CEDVVCGHNATCRVKGHEAACVCDQGFTFDPSNIEAGCLDINECDQIHGPSGLCGQGAIC
TNTIGNHLCHCPVGFTGDPFRYCEDINECDKKFGPSGQCGENAICTNILGNFNCQCPQGL
TGNPRDKCFDIDECSTEFSPNDPCDRLFCGQHEKCQLDQNNNPICVCADGFMGKSNSLSG
CIDLDECINNPCGKAAVCRNTPGSYECLCPNNHHGDPFIECVADGKQQIDCGDDLVCPMN
EECILAHSINQCVCQRGYARDATSSSCRDVNECTELKKSPCGSNAFCTNLDGGYTCHCPD
GFLGNPYSICYPELSKCTGDKQCPGTTQCINDLELGDHCGCKDPYLREGNYCILGSRNCS
SDNPCPKNQDCMITSSGFGFCICPKGFTLEANGFCRDINECLEMTEFELCGSNSECINLP
GSYDCLCNRGYTGNGKIGCYRIENTCRSHQDCPSNYRCYNQTCQCHPPFVLNDGTCEHPC
EWLQCGQNSECKLGETGPKCQCKIGFDGNPSEECNDVNECTSLLPFDPNGPCDTNYICVN
TIGSYRCECQSTRTDSDGKCLSISQCRSNYDCPHDTVCNRNWNVCVDVCAEHVCGPNSFC
IGINHTSSCNCLDGYSGDGNNLINGCQSPCSNVYCAENARCIINSKNLPVCQCLSGYFGN
PWAGGGCLPDKKCTSQKHCPTDQICFNGVCVHQCKDKNCGIGAKCEEHTNRCRCLPNYVG
DPEVFCAPPLSKAPECNPGCGENSHCAYSWPNNICECNNGTHGNPYFSCSSKITCDKIRC
GTGAVCLESATKVECVCPAGFQGNPYIGCEDVNECLQDLCDNQGAICGSNANCINLIGSY
QCVCLPGYIGNPNYACQLPKKLTIENQSSGVGISCSTNFNCPPDTVCFRGICVQRNRCVD
DTQCDSNNVCALVNNQIGHQCVDPCDTTQCGPNAFCFTLEHQPKCLCIDAHSGDPNDLDT
GCSPSSELRLPTTCNIDADCGSEFTCKHVGSEVDSKQCIHVCDIINCGPNAHCISRERRP
ECVCHENFEGNPYDLVKGCSLHACLDDGDCKQDEICSIQVHGYRECNNVCRDFSCGINSV
CRGKGHKAYCECRPNFLGDPYDEKSGCQPMQLTCSDDDNCAEFQACRRVLNGFRNCTDVC
DSIRCGQNARCVGRTHQAVCECLPGFSGDPTRQCRIPSQHLCQRDEQCPHDKKCVLTSEN
IKDCVDICYNHICGAGAHCIARNNRPHCDCIAGHTRISGDPTGACAPNVCQTNKECRTDQ
ICTITRRGVLDCVDVCDSIKCGPNADCIAIDHTATCRCKDNFIGNPEDLFRGCVPKDKCT
SNTDCQTEQVCHLNENGVKSCVDGCSVNLCGPNAICLTNEHFVTCTCDEGFTGRPSDANV
GCHKISNECFTDEQCPSNAICVHGPNEINICQDPCKQFLCGENAICSSLNHRAQCSCRPG
FIGDPFHMCLDPDECKNDKECPNDSICKLDKETNTRKCVNVCLYTECGKNALCKTHRHKA
QCFCKPSFDGDPYDIHIGCNVPVLSNLCQNDFDCKRGFKCSPTISGVLDCVDACSTLACG
PNSKCQSIDHQPQCECLPGYDGDPSDQQNGCIKYDSDECHEDIDCLNSTDVCKTLKNGIR
KCFNACQFITCGSGSKCIATEHRAFCDCLEDHVRDQNQVCIPRKDECVADYQCSAMAKCR
TNAFGIRTCAEACIDFTCSPNSRCVTFHHQEQCQCEPGFTGDPLSRTGCVPISLHKCNND
EDCPSMNEVCLADRNGVRKCTDGCSKYECGKNAICVVENRNPECKCPTSGLYLGNAYDHK
VGCVRVECITDSDCPDDKACSTQNHCYDPCINGCGRNAVCISHSHNAHCKCLPGYTGQPF
GSGCTVMRLCETNPCHELANCNDTFGSFTCSCPIGFIGDPYDKSMLGCKHPNACPQGNID
CSPSSACMPDATGMFVCKNPCDHFECGPNSICEIRDHEPKCRCIDNFNGEPNSFGCSRIP
RFCKSNPDCGDSQECIDGQCRFVCTTDDECARGERCVDNFCVKACIMHDSCSPNEACVSK
GYCNFGCRDNFECPSDQACVLNRCQNPCQIANICGQNALCSVSNHNLTCFCPENFVGNPN
PIMGCKRKYQYCTDDIECPMGQTCSNNKCRPRCSECVEGEKCINNGCFQTCSSDSNCPVS
EVCINHVCISGCRSNADCTLNQICANTLCSCVPGFKYISGVGCVDINECLQDPCHSTAIC
ENIPGSYRCSCREGEIGDGWTGCQNPGECPRGDIDCPPTAACRTNQDGISKCVNLCSYQP
CGPNAICTVVDHKIQCKCPEIGFFSGDAYNHQIGCHQVECLQDSDCPSDRQCRDFVCENA
CDRVDCGPKGACFIRDRQATCRCETGFENKGVLSCVDVDECRYHPCDPTAICENIPGSFS
CKCPPNLVGNAYSHPGCHEPDVCYNGDSDCPDSSSCVLVAGVPKCRDRCNDPMICGMNSS
CLTTHHVPKCSCPKDYFGDPLIRCEKFECTKSLDCFNETDICYENHCVNVCLAPTACGEN
SYCVPQKHGYICKCSDGYFGDPIAGCRKRLHCDSDDDCPVSEFCFMDHFCRSSCDSHRDC
NQNERCETGRCIQTCQSDFDCSSDYICLDFRCTPRIDNRCNNDNECDPNAACRADYRGFN
DCKDPCENTICGRNSQCKAFNHMAICECLPGYFGNPNDERFGCRPIECSSHQDCGPHQAC
SNHKCIDPCQHNRPICGENAYCSPQKHSAICRCFDGFEGDPVVGCQRVDFCSKNVCHPTA
ICLNKLAGFECMCPTDKNIGSPFEEPGCRGANECPNGNSDCPPNAVCELNSKGTLMCQNP
CEREDSCGMNAVCAVQNRQKICTCPEGFHGNPRDNRRGCIRDLIGCHNENHCPAGMTCQL
GKCRPQCASNQDCAANERCIDHHCSLRCFNDQECSNGEICQNNQCQAGCRVDNDCPYKES
CVLNRCKDMCDTPMSCGTNALCSMVAHQPICSCPSGFHGDPRIACSRSLRMCLSSIDCPE
NSICLDGRCKPSCLADKNCAIGEKCFNDHCVALCRQDSECQAHEICNANRCQTGCRTNQN
CAGHLVCTRNQCINPCEGSAACGPNAICSVVNHRISCTCPLNFVGRPSANVGCMRESIAC
LSNADCHSSGLICTNNRCRQDCNANKDCAVDERCVNNRCHIQCTKDRECPTSEICLQNVC
NVGCRSDSDCSSTETCINNFCMDPCASSTACGTNALCQVYNHEKVCSCNDGTVGNPFVEC
TRKFTQCDQRFSSSSVSTCESGQICHSSYCFEQCYSDKDCLNNEKCLSNICSTICSNHNS
CPNGFVCEAGVCVPGCRQDSECSTTDICISQKCMNACENPASCGLGAVCVANNHQAQCSC
PAQHTGNPNIECKFMNCVLDSDCNHNEICQNYKCHQGCRTDQNCAADESCISLQCVDPCM
YADVCGDNAICQTIDHQPYCSCPANYDGNPTIRCLLRSQEERYCKSDHDCPFESSCLHHS
CIRDNQCNRDKDCVIGNICIQGKCFAGCRRDDDCPLDKSCFQQQCQDPCTVRGACGKNAQ
CQPFNHEAVCSCPTDFIGSPETECLALPNCRRNDECPIGYLCQSNKCIQIVGCVSDNECR
STEICEKNRCIEGCRTNSDCSFKSACISNSCQNPCSMKTCGTNAYCVPINHEPLCRCPEG
FSGDAYQGCQIQKLDCHVDSDCGFGKICTSNLCIVGCRSDNNCPFDKTCFNRKCIDPCSI
ENACGVNSLCRSINHKADCSCPPNHFGDPRIHCVESKQNLEAFECSNDIGCGPGKICDHN
FCIDIVKKCSYDNTCRPGEICDQGKCISGCRRDSDCTFDRACYNSKCVDPCTVHTPCGPN
ARCQPVLHRPQCRCSFGFDGNPFDYCKPVTHRSSTLCKADNQCPLGFVCNGGFCSIGCRT
DSNCPSDLACLNKYCVDPCDLSDSCGQNAVCTAVSHRPRCSCLPGYTGDPNILCTVSTML
ICVQDVDCGVGQICEKSKCIDACRTDDACSYSTACINQRCQDPCSVYDACGHNAICHSEN
HRAICKCPSSNTQTDSFTACDRQQILLAPFECQSDLDCSFGFICNQGSCNEGCRNNEHCA
PNEICVNQECRNPCEQLNACGLNADCTSGGHKAICSCHAGFIGNPLTECHPFEEIKECSS
DRDCGHRLICERSKCVIGCRDSFGCSDEESCINGICQNPCSMYGVCGRNAICQASNRTAI
CICPQGFKGNPNVLCTDAPPQCLRDNECIVGQICENTQCINGCRQDNNCPEDRICLHGTC
QNPCLLPKSCGLNAVCQPFNHRARCECIVNYRGNPFEGCDPIPDDYCEHDQACSLGKICE
NNKCIDGCRNDANCRFEESCIDQQCRNPCELFGSCGHNALCKPMNHDRVCTCSPDFTGDP
RVLCERIVAPPECLSDAECPIEHICKNQRCAYGCRSTSNCPKDKACLQDKCINPCRQSGA
CGKNALCLSSDHVAICNCPNGFIGDPTIECREIPPECRSDNDCGMERICLKQKCLVGCRM
HSNCPLDKACVNGMCQSPCSIGGMCGVNTICRAEHHEAQCSCLPGYTGDPLKQCSKVTVE
CEHNHDCGNGYVCANNECKDINECLQERIPCGPGANCNNLPGWFKCSCPLPLVGDPYSEF
GCRPAQPVCIRDEDCTSTQKCNPVTQECYGVCGKGAICKAHDYHAECQCPNGYQGNPHVE
CTIPYNFNCSSIGSCPPNQECVYINGNQQDGVCICPRGYSLSLDGSCKDIDECQLNQNIC
GPGAKCTNLLGSYKCSCSFGGDPYNEGCISDHFREGCFLDGDCALDEVCRDSKCINPCLE
ENSCGQNAMCTTRNHQKE
Download sequence
Identical sequences A0A132A0F5
SSCA008236-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]