SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA008349-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA008349-PA
Domain Number 1 Region: 45-313
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-30
Family YWTD domain 0.0000863
Further Details:      
 
Domain Number 2 Region: 1-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000678
Family EGF-type module 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA008349-PA
Sequence length 318
Comment pep supercontig:SscaA1:JXLN01013297:676:1793:-1 gene:SSCA008349 transcript:SSCA008349-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INECAFFGHNCSQNCINLEGTYACSCKSGFDLVEDRCVAQGSPPLLFYSEGPEIRFIDYQ
GQYQSSIVIGDRIQALDYDPIEKIIYWIDSFDSSIKRAVIPDIKDPNHGMAFTQDMKLQS
PNKMIDIDVDWVARNLYWIELDIKNPRPKGQIMTSLLDGRYKRSLIVNDLERPSSIALDP
EQGTMFWTDAGFAPKIEASWMDGSERRIVIKDRLGFPSSIAIDYSADHRIFWCDAKLNSI
ESASKDGSDRTVIIHSILHHPISLEIFEDQLLWSTRDVGEIFRQDKFGRGVKVRVKKSSS
PNADIKIYHEKKYNRSCK
Download sequence
Identical sequences A0A132AE74
SSCA008349-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]