SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA008571-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA008571-PA
Domain Number 1 Region: 667-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000363
Family Laminin-type module 0.0051
Further Details:      
 
Domain Number 2 Region: 186-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000181
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 3 Region: 713-755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000229
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 4 Region: 825-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000218
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 5 Region: 360-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 6 Region: 877-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000246
Family Laminin-type module 0.0039
Further Details:      
 
Domain Number 7 Region: 928-970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000544
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 8 Region: 777-827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 9 Region: 309-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000187
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 10 Region: 124-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000879
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 11 Region: 273-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 12 Region: 619-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 13 Region: 1405-1561
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000288
Family Tropomyosin 0.0038
Further Details:      
 
Domain Number 14 Region: 976-1023
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000356
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA008571-PA
Sequence length 1628
Comment pep supercontig:SscaA1:JXLN01004265:4920:10654:-1 gene:SSCA008571 transcript:SSCA008571-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIERSHDFGRTWKVYQYFAYDCAQSFPGVQIGPRNRITDVVCDSRYSHVEPSTEGEIIF
RVLPPNIRISDPYAKEVQDILKITNLRINFTQLHTLGDNLLDPRVEVKEKYYYAIYEMVV
RGSCSCYGHASRCIPSNHETVPDMVYGRCECTHHTKGLNCELCEDLYNDLEWKPAIGRQT
NACKKCECNNHASRCHFDMAVYQASNNVSGGVCDDCQHNTMGVHCELCRPSFYRDPNRRL
DDPYVCQQCDCDPRGSKEEGNCDSYTNPALGLEAGKCSCKTNVEGRRCDHCKPGFWNLHE
INPDGCEACSCNQMGTVGNLGCNVNTGECVCKRNVIGRDCNQCAPHYYGLGADEEGCKFC
DCDPGGSYSPDCDQVTGQCRCRPHVTGRRCDTPESGHFIPHLDHLTYEAEEAKTVRGSPI
MTVRNYDERMFWTGTGFNRMPPDCGIEFDIDNVPTSKLYDVVVRYEPETSGRFNNAQLKI
KRPYRIDGYGPCANYSSNNDVRTFSLSSGERSAIIDNVCLEKGVHYQVELDTNQFERPIY
NGESPSVLIDSIVLIPKANDIPFLTDSPDNPQRQMYDFEHRCLNQYYRLNMNRGKDIDEY
CRKSLQSAGLYTFDGAHPCQCNPTGSISTECETLGGACQCKPYVAPRTCDRCHVGYYGFG
PDGCKACDCHRIGSLDNDCDPSTGQCNCRPETYGRQCDECQPGYWNYPNCQRCDCNGLSD
MCDSKNGTCIDCRDNTAGPHCEECAEGFYGDPLGRMTGTIVPCRPCPCPGVEEYGMSHAK
TCQLDPRTQDVICHCHQGYTGERCDRCDENYFGEPNQPGGQCVSCNCSGNVDISQSGNCN
SKTGECLKCLYNTDGPNCEVCKPGFYGNALEHTCVECVCHHLGTDPRSAFCNQTTGQCSC
LPNVEGLSCDRCADNHWNLVSQKGCEPCDCDPQGSLSMKCNEIDGQCHCKSTFGGRACDE
CLPNHYGNPRLQCKLCECNLAGSSSMQCHKVTGDCICIDGISGPKCDRCARGFTGMVPYC
EGCGECFESWDNITNILKKETFHLLDKARQIKQTGTTGAYTKEFTQIELNLDEINKILEG
QNINKFDLERVQHMIMEAKTNLLSLQDTLNNHEKQLEDTKTNVIDVNFKLDLLANKSAEL
EAEATALKERTFTLQEANVEGAYNMTKDAQRRSRASKNLVEESSNILTESETKRRNTELL
IDQPKGQHNWTFQENILKGIQQEIAEMESGLPNINHLVCDGFSTIDDCDTLCGGAGCGRC
GGLSCTKGATTKASTAVELAKKAEQELKDKDRAVKDELRRIKEAREKSDEALEEAKAAFE
RIMFAKNTSTNTAVEVNDLLDQIQKFLSDDLAQAKDVRKIAEECKQNTISLDEDQIRNLA
LEINKTIAGLKDIDRILDETRDSLAKAQNLKIKADSAKIKANDILSVAERVKKTLQEAAE
AQRKAKLSIDKADQAINTIDQNLQEIDEKAGRAKNDAEEAKMKIGDLNDRLGNLTKKYTS
NKFNIENAEKEAYNATAYSNEANKMIDELEQKYQNAAQKLDQKSKVSDDLKKRAKDLKDN
ASILLNNVSVKLKSIEGKNKSIYGLMIGFTLKLSLSLSLSLSVFEQNSRMISITMTKNWM
IFVKRSKS
Download sequence
Identical sequences A0A131ZYG1
SSCA008571-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]