SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA010041-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA010041-PA
Domain Number 1 Region: 74-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000116
Family EGF-type module 0.054
Further Details:      
 
Domain Number 2 Region: 38-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000988
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA010041-PA
Sequence length 166
Comment pep supercontig:SscaA1:JXLN01014700:1420:2805:1 gene:SSCA010041 transcript:SSCA010041-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSQHCPNDCHSRGYCHHGSCQCFPGFLGPDCLDNVCPILCNGNGQFLQGSCHCEAGWKGR
ECTIPSNECEISDCNGNGHCSQGSCRCKPGFKGEHCDQRTFDFETNQCVCHPYYDGENCS
EIQCTMDCGLHGSCQKDRCHCDEGWSGPNCQSKNCDQRCLEHGQCL
Download sequence
Identical sequences A0A132AIC1
SSCA010041-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]