SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA010115-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA010115-PA
Domain Number 1 Region: 186-312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 83-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.007
Further Details:      
 
Domain Number 3 Region: 123-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000455
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 42-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000151
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA010115-PA
Sequence length 495
Comment pep supercontig:SscaA1:JXLN01004004:9359:11764:1 gene:SSCA010115 transcript:SSCA010115-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWTGQDCSKCVPYPNCKNGYCNIGMECICKEGWGGLLCDKDLNYCTNNQPCQNGGLCSN
TGDSFTCKCPPGFAGEYCERKLDSCEHSPCLNGATCKQNNNQSNYTCECPLGYDGRHCEH
PLSACLNNPCENEGSCIDGPSGFLCACKIGYSGNKCQHKQKGCQPNPCHSGTCFSNGTNN
ESYQCQCRAGFTGDHCEININDCESNPCLNSGSCIDDINSFRCRCPPGFIGQHCELNIDE
CLMRPCANGATCIDRINDYQCICPSGFTGKDCSINIDECATQPCLNNGFCIDQINGFECS
CPPNYSGLLCEILIRAENSTSSSSSSSSMFYTTDDKNGMDQSIQNISAAKTSRTSSIVII
VVGAIVLIILISVCLVVCKQLKHQGIKLNRRKDEAEAQRQNEHNAIMNSMNNKYLDQCLN
RSAANVIVNPLNRPASIHQLNKCHKITNEYVHSAQLNKYATMHHDGYKTKQINNEQHYSI
KMSNHHPNTVQHTDD
Download sequence
Identical sequences A0A131ZW37
SSCA010115-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]