SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA010581-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA010581-PA
Domain Number 1 Region: 23-151
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000209
Family YWTD domain 0.0025
Further Details:      
 
Domain Number 2 Region: 204-243
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000668
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 163-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000277
Family EGF-type module 0.018
Further Details:      
 
Domain Number 4 Region: 244-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000759
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA010581-PA
Sequence length 497
Comment pep supercontig:SscaA1:JXLN01010401:22120:24281:1 gene:SSCA010581 transcript:SSCA010581-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDSPDNKFILFFQFIFHPFLLSRSTLFWTNQINTPRIERISFPNTNKTTVIKDRLKKII
AITVDQDLDLLVWFDLMANKIEYSSLDGYSRRTLYQEDDIHPLSIAAYDKYLFWIEKDKK
SVEKIPLDLNHGRNKQTIFIKDHSLTDIIAVPLMLKTSSHLYCNNENGGCSHYCFINNYL
GSFSCECPQGLMLANEEPARRCIQQVECAPDEFRCRSGKCLPGSLRCNKIAECADGSDEI
DCPICSANQMTCFKNNKEVTCLDRKHFCDKINDCAGGIDELCCVSGLDTLAPDVHGNNAA
NKIGTPVPRSIACLSTAQSESLIERNVTGASSTSSSANLGVYPSKAFNNPPPSPATERSQ
CSTLSSSLFVTRPRLRQKKCSGVFSAGIAMGAGQKNRKKAYKKKWNNKSASNRCPPPTPC
STDVYEDIEPCTIKYVFYDNTQAEMDDDLDYKPPPPTPRQYFSDLSCPPSPVTERSYCNP
YPPPPSPIFPQQMNDYE
Download sequence
Identical sequences A0A132A3V6
SSCA010581-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]