SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA000163-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA000163-PA
Domain Number 1 Region: 2838-3013
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.44e-37
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 3243-3414
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.7e-29
Family Laminin G-like module 0.00092
Further Details:      
 
Domain Number 3 Region: 3420-3608
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.76e-27
Family Laminin G-like module 0.00095
Further Details:      
 
Domain Number 4 Region: 3010-3186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.34e-24
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 2625-2672,2700-2827
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.51e-21
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 6 Region: 1414-1464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1769-1821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000781
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 8 Region: 730-780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 9 Region: 1873-1927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family Laminin-type module 0.0035
Further Details:      
 
Domain Number 10 Region: 493-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 11 Region: 354-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 12 Region: 539-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 13 Region: 630-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000022
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 14 Region: 295-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 15 Region: 1827-1875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000012
Family Laminin-type module 0.055
Further Details:      
 
Domain Number 16 Region: 585-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000159
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 17 Region: 783-821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000198
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 18 Region: 1730-1771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.069
Further Details:      
 
Domain Number 19 Region: 675-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA000163-PA
Sequence length 3609
Comment pep supercontig:SscaA1:JXLN01001762:31403:43373:-1 gene:SSCA000163 transcript:SSCA000163-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQPKANCSLQPTVILLIFFLNCIQIFDCQVLNPPYFNIAEGRNITASDTCGENVPEPEL
YCKIVGSNWLDESDNFNLIEGQACDYCDPSDPKKAHPPQFAIDGTERWWQSPPLSRGSQY
TKVNLTLDLGQEFNVAYVFIKMGNSPRPGVWILERSRDYGKTYTPWQYFADTPQDCSHFF
GKHTLQPITRDDSVICETKFSKLVPLENGEIAISLINGRPSADNFSMSTTLQEWTTATNI
RLRFLRPKTTLGHFISVAREEPTVTRRVSFAWLLIEIFKTKFLQILLNINIGGQCVCNGH
ASQCDQNSPADPLKLSCACQHHTCGWQCEKCCNGYQQYEWRRATVDDPFVCEKCNCHGHS
NDCYFDAEVQAKNQSKNIHGRFEGGGICTNCQHNTTGINCDKCRDGFYRPKDKSLDAIDV
CQPCQCDPKFSTGNCFDETAQCECKKNFKSPDCDECNIGYFGFPECQECHCYGGKYCKEC
QENYYGFPSCQKCKCNLDNSYNNSCNIETGQCHCLSNFGGVNCDECNIGFKNYPKCESCQ
CALEGTNEKVCDNNTGECFCREGYEKPFCDKCAKGYYGFPNCIKCDCNLEGSTSTACDKD
GKCECKSNFGGLKCNDCAVGSFNFPKCEQCRCHWRGSSGISCDHSGNCLCLERYEGQKCD
QCKEGYYNFPYCEECNCNPAGLVAEFGGCDKVEIGKLCECKERVKGRICNQCKDLFWNLQ
MNNPYGCEDCRCNQNGTVSRIGICDTITGNCMCKNNVQGRTCDMCKPNTYLLDSANLFGC
VDCQCDVGGSISSDCDKLTGQCRCKSRIKGKTCSETLDATYFPTFYQFQYETEDWFNPSG
SPARFGYDEMVFPNYSWRGYAVFSPLQKEILTNITITKTSIYKVIVHYVSKNNETINGVL
KFIPYEWMNSEPQTVSINMEPTSSPKLLYVTGRQLNGMVSLGVGPWQIFLQADKPDLYVD
YIVLIPQAYYDPGLFQERITGPCLYLNSNNLSCILHSFPDFPESGKTLPASEAFVMKDSG
QVKPPVIESKTYHEKLNENIGLVQMDNENSNLEFDFVANNNGTNILILNYHTPNNLNDSV
PIQIELENISKNITMETDNILSACPYLFICRQAISTKDGRLLSFDSTSDDSFRLRIKLLD
QDENITIATTEHSPPPPGQTDFKPAAINDRTLNVNKIVMIPLDNKWSFDYIEPSFVCLSK
NDNCTASIFPTVADGIKVEAESEQKQDHIVQLPKYNQAIPIFEQKPYMVELNESMPSIDI
RGSVPKPGPYHFVLNYYQPKNPKFNVDALIQNGHLFSGVAQLQHCPNTVGCRVALQQRDS
ESNSTAFNIQNNFLLTLKIPKTENIFVDRWFSPQPCKTGFYGWPDCKKCDCPSTAICHWK
TGDCICPKGVTGKDCDKCLPLTFGFDKIIGCEDCACDPRGVLNRDLRCDLDTGDCKCKQN
IVGRTCDKCRAGFFGFPKCQLCRCDIRGTTPEICDQNSARCFCKKNVDGAYCDHCKSDSY
FLEESNSQGCTKCFCFGNTDRCTGSSYVFVPITSNNIELELYNVSLYGQIFEAIRLKKNE
DYELDYTNNIFSIRTSFGREKSETNPENPSSIYVQLPKEFLGNKISSYGGLFRYSILNKA
NSKDYEPALLMADIILIGRNHTLLHEHIEQPVINENFTVTIKLLEKEFKGMDGNFVTREQ
FMMTLVDIKAIYVRIKYFNLALDTVDIEFEFQMETAVPGNKIIDSNYRKATSVEQCLCPS
NYRGASCEECAEGYYRVQQGPYLGACIPCNCNGHSNECDPITGQCFNCKFNTKGDHCEQC
TEGYYGDATLGTPNDCLICACPRPIASNNCEVDHSGSVLGCDCKEGYNGTRCEFCGAGHY
GNPQIAGQSCQKCECNNNIDVKDPESCDPFTGICNKCLFNSSGEHCERCADWHWGDSIIS
KNCTECDCNQCGAEYCDHKTSSCKCKMNVIGEKCDRCAPGFYGFSTCNGCQPCNCGEASN
DFNCDDSGQCPCKTGAAGKTCGTCAPGFWDYSKYGCTSCGCNENYSRVKQCNQLTGQCQC
LPGVVGAKCEKCPDRWVLIPESGCQECGDCIHTLLDDTDQINENIIAIESQTQNTSSSIL
QNRKLNNIKERMDSYAGLMNTTFDESNQRANNLRNFTTIKKDSEDLLEDIEKIDIKSDSF
EENTDKVLVKVMKALNDSLMAENKVKSVRQLTVQAVENINQLENSFNDHAVAQNLGSINE
SEQILQALKRPYIDNYMERFNIDLGDFQETLESSENFFRPWSKVKEDISMTKDKLGNFFN
LIVELKNLTNIARRDAVEAERVVEKRLNDSIQSSIVDLNDHLTQAITLLQDADQFINKSN
KNFGDLENMRVDIEQQKDRLNKEMETLNRFDKIAEEISEIENVVIDAEKHAKEQKFQSNY
LNEFMASTKNKAMDPLKAANAYDNISRTIEANEEIVRELKEKLQPFQNDPLSEDLDKSDE
LFINEKLEQINNSTEFLKENEMMINEISKVIDEKTDQFQKLNHSLMNLESIDPKTNSHEK
IKDQVDQVYRTESQVNKLRDLIDNLKNKSKEIKDYSDFVNDIKEGKDYVDRFDKDVERTK
NITTSDDINDLTNEFNKIRSTISNKISDLKKRIQLARHQANNMRIGVRLNENSLLELNNP
SNLIESSTYNKFSMYFQPLDSDGILAYVGNPADIVSNELVKRETVEMDPDAKSKRKQINH
DYFVLELRRGQVYLIWDLGTGQPLVVPHHQQIVPGTWNQIIVERFGRLIRMSLKINENSA
PIIVEKEASGSASVFNLDRENSKIYIGNIPPNVPVSSNIENRRFRGDISDVYLDNEPLGL
WNARESQYLESVPGPEMFIENALRFNGNSYVIMARNNINFKETVYVSFQFKTLIKNGLLF
LVGDPNRKVFFSIELVDGQVVVKYDLGSSYTTVVSNDRYNDGKWHFIKVNREGKECLINV
DNNDEQSGFSMGLSTDLHTDDHIYIGGFKGILPYYDVGKEGFDGCLKDLQIDSNQQNLNN
HKESFGVNLGCSTFVRIVSFAEAGKSHIVFENQTIDTLSTKNNVQIAFKFRTLAKIGLLW
NYSVLDLSEYVSLFLYDGMLILKMSNGQELRTDNQFYNDNKWHYLTINFNKRILEMDVDD
INSFSLIVDSPIDLDRLETIYIGGMPFESLYANFVGCIGDVTVNYKFLNFADSNSMMNAL
FKKCPLAINDDEFDDNNFRDLLTPETYTKAPDIQYLPPIKDCKLAPIPQPANLTDSDPNE
KRFGGSLWSRYEFPMTNEIAKGLEGESGFQIQFKTSQAEGIIFYITSSNNIDFIGLYFLN
NKLYYSFDCGSGRGVTMLPNNYSDNVWHTATFSRKGRNGLLRVDEETVEVTSVGSTSSLN
VKSPIYIGGIPKELRSQIKGHLKSVEKNDYNYAMVSFSGCLKDLKVRDIEYNFKDGREFD
VAPCSPQNEYGHFFHYDGGYIRLFDEFRVRVQFTLILEIKPRKPDGILAAVFGSNDYLVL
YMDKGDLVFSVDNGAVPITAKGSAKGSICDGEWHVIKAIKTKNLVMLTVDDNLPIISVGQ
VGISSTDTKDPLYIGGLPEKLKQEKRLKLDNIVDDYLGCMRINSINAKPPTFNNAKIEGH
ITLNTCPID
Download sequence
Identical sequences A0A131ZUE5
SSCA000163-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]