SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA002608-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA002608-PA
Domain Number 1 Region: 559-650
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.57e-38
Family Small-conductance potassium channel 0.0000109
Further Details:      
 
Domain Number 2 Region: 430-599
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-28
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA002608-PA
Sequence length 840
Comment pep supercontig:SscaA1:JXLN01016874:22689:32107:-1 gene:SSCA002608 transcript:SSCA002608-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSEPEHPVPLIELASLEPLMELQPNINPNYRSCPDINPERNAQMMRKMDSISNNNVVGG
AYVNFQNDNGGSFCREASISSTRSSTIAPYSNDHHQHHSHRYSISNSCGSDSFSGGGGYN
SRASPRVKRHLWPSHARSVLSSRLEHTPYAPGSHLICGSSILRSTNCASNCLYHRPSLLD
NEIAEIAADSMRINGALRQFRQLRKATASTLSMPVAEKGSFTAANSLDVTADPSTPLMNA
TSDHRSPQPFNSQRSFASNSLDSDKKKSTNKSGFHKPNVGYRLGRRKALFEKRKRISDYS
LLMALFGILLMIFENELSLPGIYEKNSVYSYAVKTLITVSTLILLGLILAYHSLEVQLFM
IDNCLEDWRIAMTSQRIASIILELIICSVHPIPGKYEFIWTTKLVNHGGRFETKSVSVPV
DVILSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTCL
MVVLVSLWIIGSWTMRLCERHHDEEHANLLNTMWLTAITFLSIGYGDIVPNTYCGRGIAV
FSGLMGAGCTALVVAVIARKLELTRAEKHVHNFMMDNQLTKRLKNAAANVLRETWLIYKN
TKLTKKVNTSRIRTHQRKFLLAIYSLRKVKMDQRKLMDNANTITDMAKLQNNVYEIVSEI
NARQALIDAKVLTLEERMLIIFEQIEQLPETIKKIVHNNNNHNHRESLTSSFQQQQQCGS
LPTLVENLNSTTIPVSITTYNHNQNQKYLRKNDSEERTLTPQLSPPPSHPLPMLSKSSTS
KHTFLHPNDAASISNRPSWSTSNLNQSNTNYATNVVSNSSPQSSKHFLTPNVLRTTSFDA
Download sequence
Identical sequences A0A132AK43
SSCA002608-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]