SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA004096-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA004096-PA
Domain Number 1 Region: 55-87
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 111-145
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA004096-PA
Sequence length 226
Comment pep supercontig:SscaA1:JXLN01015925:15990:16903:-1 gene:SSCA004096 transcript:SSCA004096-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAIKRKLLLLLTSVLLLLNIFTPIISNQSNIELIDSKSGDYHKDNSERNETKQSCPSGQ
FQCLHSKVCIPIGWLCDGENDCGHNSNTNETNHSSLIDSSDEDSERCQANFQCPYNYFRC
ANLITCVEMQNVCNNHFDCPDLSDEGQFCENNSTCLELDCDYGCRPLPKGADCFCPKDSK
FNGTHCERNIVYSKINAIKFVTKIMKLFSVIVSMVMFFRTKPNALL
Download sequence
Identical sequences A0A132AJ81
SSCA004096-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]