SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA005299-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA005299-PA
Domain Number 1 Region: 191-210,325-497
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000721
Family Trypanosoma sialidase, C-terminal domain 0.047
Further Details:      
 
Domain Number 2 Region: 155-207,502-587
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000022
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 81-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000224
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 4 Region: 51-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000759
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 125-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000146
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA005299-PA
Sequence length 597
Comment pep supercontig:SscaA1:JXLN01004287:22099:23935:-1 gene:SSCA005299 transcript:SSCA005299-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAFVRSGLFTPPLQSIGISFLISSRYSGSNCEIDVDACSFDLFGNLSAISDRCYNGGTC
KDGPGDRYFCVCPPGFSGAKCETFLNPCRSSPCLNDGLCQPDGHRFKCICPYGWSGSICQ
QPMRQCHNSSRCLNNGLCMTTNSIGEEENKFRCFCPPDFHGDYCQFKFDECRPNDCKNGA
TCLDGIDGYSCRCPKGFAGFYCEIDCRQNYLTDLCLLWNLKNEDNDSDINLFPDSAIDLT
SLSSTQTPSINLSSSLTTTSLPSTTSAAELSVQDVPETNRSQSSIVTFETINEPSSYPKS
ISNDSMEFELKNKTNFSTTRIYSPRFNGKDSKITYKLRRLKRTESSLRTGLISHNENGTI
LHAYTNRFNLLIYLEKSLVQMELNDQNQQNLLHLGNDVPIKIGKPYLIEMNLQSRQQSLD
VEFNLFNAYDGQLIESKALTNQNLTIPCFEWYRFGQPPSVTDNELFLKPFDGCLFRIQLN
NELKLVHDSYQIENIDECYDNVCDMKPCLNNGRCLFDRLKTDWTCSCPIGFRGWLCEEAH
CTQDYCSNGGLCLLGDNKIENDFHRNQHRHHEPLCICPQGFLGFRCEFSSVESFFLI
Download sequence
Identical sequences A0A131ZWB2
SSCA005299-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]