SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA005311-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA005311-PA
Domain Number 1 Region: 373-447,475-617
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-23
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 2 Region: 179-214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 38-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 226-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000623
Family EGF-type module 0.024
Further Details:      
 
Domain Number 5 Region: 139-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 6 Region: 327-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000639
Family EGF-type module 0.028
Further Details:      
 
Domain Number 7 Region: 109-138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA005311-PA
Sequence length 637
Comment pep supercontig:SscaA1:JXLN01012099:12006:15047:-1 gene:SSCA005311 transcript:SSCA005311-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRDAIMAVAYQVNGFVIDSMIVVISAMRDVSMNVTSSKRCTSGEFRCKHQTDECIPLIK
VCDNRTDCLDRSDEINCVWNYQNSSSNDSNVDNISITIQTSTIVGDRPFRCPIGQFWCEN
GLCISDLYLCDGDNDCGDQCFTEEFQCRTDRKCIRNSWRCDGDKDCDDYSDEEDCIESMI
ECSIGSFRCRDGTCISLLGVCDGAPNCPDGSDEDTNSTCLANVMPCHEQGFPCQHLCVAT
KTGHYCSCKEGYRKANDGRSCIDIDECLTGNLRAEYLDHEHHHHHHHHRHRSNGTKININ
NNQYDEKKIANNSARKNPKFFLLPNIQVCSQKCINSVPGFQCSCADGYRLRSDGQRCEAI
ETRDDPILLAIVDPNRLSAFDIDSMMMGNLLRPPEFRSPNHSSSDEILNHPKILIDYHFQ
RKTLFWIDKKAKKIFSAYIKIENQNYKDKRKDRFLNRKNQTSRSTKNATSRVVLENLHPI
IKNGLADPNGLSIDWIHQRVFWTDSSASTIEHSGLDGSDRTILLSKYNGDGLQRPKSLVV
NPSQQTLYWSDWGPKARIECSFLDGTNQRIIISNLLQQPSSLVIDYPAEKLYWIEPKLSL
VECSNLDGTNRYTIANNEQIIFIGLVSKRVKSMLSIN
Download sequence
Identical sequences A0A132AAQ2
SSCA005311-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]