SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA006940-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA006940-PA
Domain Number 1 Region: 3467-3570
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-29
Family Cadherin 0.00057
Further Details:      
 
Domain Number 2 Region: 1993-2129
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-29
Family Cadherin 0.00082
Further Details:      
 
Domain Number 3 Region: 3253-3376
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 2747-2867
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 1321-1434
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 1224-1333
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-25
Family Cadherin 0.002
Further Details:      
 
Domain Number 7 Region: 4122-4360
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.78e-25
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 8 Region: 3572-3685
Classification Level Classification E-value
Superfamily Cadherin-like 2e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 3362-3465
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-22
Family Cadherin 0.002
Further Details:      
 
Domain Number 10 Region: 1425-1545
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-20
Family Cadherin 0.00097
Further Details:      
 
Domain Number 11 Region: 2655-2759
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 12 Region: 2542-2647
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-20
Family Cadherin 0.0016
Further Details:      
 
Domain Number 13 Region: 3160-3265
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-19
Family Cadherin 0.0018
Further Details:      
 
Domain Number 14 Region: 3673-3800
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-16
Family Cadherin 0.0023
Further Details:      
 
Domain Number 15 Region: 533-651
Classification Level Classification E-value
Superfamily Cadherin-like 4.82e-16
Family Cadherin 0.0034
Further Details:      
 
Domain Number 16 Region: 774-884
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-16
Family Cadherin 0.0028
Further Details:      
 
Domain Number 17 Region: 2106-2208
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000328
Family Cadherin 0.0055
Further Details:      
 
Domain Number 18 Region: 1110-1230
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000327
Family Cadherin 0.0044
Further Details:      
 
Domain Number 19 Region: 1679-1785
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000428
Family Cadherin 0.0047
Further Details:      
 
Domain Number 20 Region: 2972-3070
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000157
Family Cadherin 0.0026
Further Details:      
 
Domain Number 21 Region: 2202-2324
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000571
Family Cadherin 0.0019
Further Details:      
 
Domain Number 22 Region: 696-780
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000842
Family Cadherin 0.0037
Further Details:      
 
Domain Number 23 Region: 2856-2922
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000314
Family Cadherin 0.0041
Further Details:      
 
Domain Number 24 Region: 1898-2005
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000371
Family Cadherin 0.0098
Further Details:      
 
Domain Number 25 Region: 883-950
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000571
Family Cadherin 0.0059
Further Details:      
 
Domain Number 26 Region: 1530-1635
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.0077
Further Details:      
 
Domain Number 27 Region: 2451-2554
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000228
Family Cadherin 0.0059
Further Details:      
 
Domain Number 28 Region: 4448-4492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000373
Family EGF-type module 0.02
Further Details:      
 
Domain Number 29 Region: 4365-4403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000426
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 30 Region: 425-545
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000771
Family Cadherin 0.0073
Further Details:      
 
Domain Number 31 Region: 3792-3881
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000257
Family Cadherin 0.0086
Further Details:      
 
Domain Number 32 Region: 1795-1890
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000371
Family Cadherin 0.01
Further Details:      
 
Domain Number 33 Region: 4485-4517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000863
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA006940-PA
Sequence length 4742
Comment pep supercontig:SscaA1:JXLN01003741:5650:22112:1 gene:SSCA006940 transcript:SSCA006940-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFITILLMNNSSILVNANQIPTNNAMETAKHHNFSYSSYLVNENHHLGDILSSPSSSTAS
SSFQNTIASLRNKTTIKAHTDSDSFVDNDVGDEDDNNKNGDGDVDGYGDHDDFIHDIINK
FTNINIKNIMNPSDNNQNVSHHHHRNDIEDDGTKQKQNSNASNQNHVSIESTNSDDDDDD
DDDQDDGDYLRHQHHHHSDDLGGTNNDDLIVEKLSPPSSERSNIKNQTILQENENNNETN
NSSNNQKQQKQQQNYHDSINENEIFADFQSPKNNINDNNDKYFGDMMNKSKFNSNQNHSK
DDSISIDKINDDKSHHKLKINVVDSISTTSSSETKSNENSDDEQDTRKTSTTIPSPQATS
SSSSLLETSTIAIDETNLIQTSDIDHPSNLIPDGTKIPNPMHHPHHHNDDDRSDQKEPML
ISFEFTKPHYHATIPENSMSKVYASSEEKMGIYISDQNLLVRYKIVDGDEEKIFRADHRK
VGNFFFLLIRVRHEKNAVLNRESRSRYQLKIRANILSERNKSIRFKAKCVVEIKILDCND
ISPIFFEKFYSVNVNEDVAVASNLFQVEAIDPDIGMNGEIYYYLREPNDYFAIHPTLGVI
YNTRPSKDCGGLESNQTIPITFDDEHFDYGLNFSSRKYFTEIVENSLIGSVVIKLEVQIV
FRNHLYRSNHHHQGLKHNRRSSLSESNSSQFNRDRNDFSEDQLSLRYFIIEGDENETFGI
TSNGVVYTRKRLDSETISQYLLAVMVEDVSFGGLGRLRSKNATTTINIDLIDSNDNYPVF
KSVPKSGLIQLAVNENKPNGSIFFHVHAEDLDLDPNNRFISYELIWYGETNVSLPFAIDQ
FNGELSIINPLDYELQRRNYLLFVRASDWGEPLRRQAQIALNVTIKNSNDHRPQFIRTNC
TLMIPFDLKPNTKLIQMKAIDLDGDSRLHYRMFNDDADVERCFRIDEQTGQLELICDLRK
EFRLNESLNHQSSPPILLQSKFLNKTQWKLSISANDGHYFSDANTIKIVVVSTTRTNDND
IMSLVPLRRRKFIETETNEIRHECTVSGIENEFRQQNLVQNSLRNSWQLSSKELETLESI
REQFRTKSDRDHNHNHNHHHHHYRFSAQDDDGSPKFNQSIITINVREDFGVNQNLTKIKT
IQKSDQDTESMHNLLLWSLNLQEFVNDSASKAYFDIDPNDGTIKLIEALNFEKQKEFELQ
ITCCDQITEKCSNLTLMINVLDVNDNYPQILDDSNVFNVSESIKPNTMVGVIHSIDRDSG
QNGLLEYCLENHHDTFVIDLYNGSIYTIKELDRETIERYRLYVIVSDRGTPSLSSSTIVT
INVIDVNDNAPKFYRNSYFMKIREDLPIGTRLMRIAAFDPDQDLASRLHYRLDTTGNDSF
AIDETMGFISIKKSLDYEQVQLYNLTIVCHDDGEPMLSSTVNFLIEIEDVNENYFPPKFS
NFYSNATVQENVPLGTLVLKVSAIDPDDPNQSVRYQIIGGSGLGRFQINSFGEIHTTMPI
DYETHQNFWLTIAARDLAAVPLISYHEVYIEVENINDMPTVTEESFLKVTIKENIPIGTE
ILRLNLIDQDHSIVSRSSSRTMENNNTRTLLEFRLLQSDSEDSTMIPFEITKDGRLLTTK
PIDYETHAHYVIDVEILKPCDTSLTVKTLTEVKNTIFTETSQCSLRSQTPIIIDVENLNE
FAPKSITSIYRCFVYSDVVDYSLPVCRIIASDLDDDDERCPISFKIFEGNEQNYFELDDQ
SGFIYVADGIKTIPKDSYHFAVNISDNCNHPRALSTTVKVLIRVLVVNQERSSSNHPPSI
EPFDSIVLVNRNQPVGTSIAWIKTIDQDNDRLSSHIIDGNIDDSFDFVNNELIVIAKSLK
NQPASQFNLTLMTSDGMETSKRNLLVNVIDEINSKIDFDQDRFVVNVYENITVGTEILQP
MVAEKHRAIFSLYSARSPDTLARFELETWSGKLKIKNQLDFEQQKQHRLLIEARKGYKSS
RFSYQRAFAEIIVNVLDVNDQAPKFTSDSFEATIAETSSVGTSVVQIQAYDLDFGDNGRI
SYSIVAGNTANVFRIEPNLGFLTISKPLNQTKRSAYFLLVKATDNGTPSLSNTTSVQIYV
TIPDNLPPRLEQTRFMIDVREDEKIGTILLSLRTLNKQTCFFMIVSGNEDKRFAINVNNG
ELYLNQPLDYEQNDHYQLQIEITNLIGIKTQAQIFISIIDLNDNAPVWDRNVFMGQIYET
ASIGSFVSIENDDDNPLIVSAQDKDSFHNLIYQIVDEKARKYFSIEPKTGVISLIRAIDD
CKLHQKLEFLVSVTDDITEHRLRAIDDAKVSVKCLPVYNCPPTFVLDRFYSKLWLPTFRN
VIVTQVKAIDCDAKHHPSDRHQTAPHLSAMMSPKLRYSLVPSIKQNFSIDKIDIKIWNKF
AINSSTGMIVTESNDIPIGNHHLWVYVNDGEFESKAKVFIKVGALPTSSLQFLHSRFNVS
ISENLNNTYTVLIPKVIGNFLHEHLIFRIMTPTSFFKIARTSGALLFTGPAIDRETISKM
ELAIEVESISHKNRISQALVSITIEDINDNSPRFIGLPYNFIYNSDFVQGDQIGQLQAID
LDSGLNGRIQYRIVSGNPSNLFELNPQTGQLSLARSIDLFKDPNNSTLLVVAKDFGQPSL
QSSIEVNLRMVIGGIPIFLQSNYTVAVSESHPPRVPFITIKAESSHGRQIFYQIESGNEN
NQFYLDFNTGTISLVEKLDRETISEYNLVVSATDALSEAQSYANVLIKVDDVNDNRPMFN
RFFYEVEVLENLKVGSKILRLEAFDEDCAPNARLQFSIQTNHTHFYVDPNDGWIFLRNPL
DYETQTKHQIQVTVQDSGSPTILSSVAEVLIKIKDVNDNPPQLPPTFTVYIDEDIDRKEF
VTKISAYDADSINQETLSYRIVSGSDSIFYIERKSGIIRINSLYRLYSFQKTWDRLARPA
QLMKRRHQLRIAVSDGIHSTEENYLIVIKPANKHSPQFGRSIINLALDENQPIGSLVLDK
LDAIDQDDSDNDEYDVDYDMISYRIVNDLGQKNFQIDSKTGEIRTRTELDFEQSIHRSHS
LTILAQDKVNSTILAVIALDDDYEPENRIIEYSIYNYHEQNELENQIFDDQTSSKQSSSS
ELFQEYFDLSSETGYIHVIDVTDGRHQNSTILYLAVADVNDSPLRFEQPISIAAIYENSF
IGTVILPVKAVDDDLNPEIKYFIADGDPLHQFSISLSGDIYVNKSLDREAINHYRLTILA
TDGKYHCESRVLIDVLDVNDNGPVCLKSKYVEMVSESVSIGTSILKVEARDQDESPNSWM
LFVLTGDHHGHFQIDPENGHLRTNQSLDRETIASYLFNVVVFDYQNHDWHCTSVVEILLS
DVNDEAPKFVPGQIQMIPLPEDSPVGLILGRVQAIDSDIGMNRQTIYELKDSTGEFLINE
NTGIIRLAQSLDREQKSFYNLTIVAIDSLRPELNSSTFFQINVTDINDNAPEFELQSYRA
SVKENALIGEEVIKLFATSRDAGINAEIRYQIVNGNLNDTFKIDPNTGIITVANQLDYEN
INEYFLIIKAEDRGEPPLSTEVNLVINLIDINDQRPKFLQRSYDIVIREDANVDDKIYQA
VASDADSPSNANLTYSFVDGKLRYKEFRIDPISGVLTIAKQLDREMISSYILEIFCSDNG
QPEPLNSSVLINIEISDYNDNPPVFDKINQTIYLQETVPIGYEILRFNVFDADSSINSGP
FRFSIEEEGGDDINQFFELDQQDRSILRTKSSLSKRKRSEFVLKIRAEDSGTPKLHSFDW
LTIIIVNESQSPPKIYPLSIAINSLDQFPGAIIGKINASDDDIHDKLVYNLIDAKDREQF
EIDSGEGYIRAYPGLDPGKYHLNVSVTDGKFVSFGAVEIEVFMITEKMVDNSIVLRIYSI
GLNDFINNHLRSLIRSIKNLFKVGMKDVIILSLQQQKPSKQARKHRAMRTARENRHRSEE
DDISLMLVIAQSVQHKLATNIQQTDVQNQIEQDSREASKSDDIENLNFYSRDIARAKLLE
NKYYLENQIGLEFDEISNQSVCEQIRCENNGTCLEELTLSEEKITYIVSQKATFVSPNHE
LKSGCSCRAGFGGAHCEKPINECHRNPCPFFKECLPVSTALGYVCQCPFGKSGPDCSQNS
ETCLTQQNDVAVCYQASNPISFGGNSYAQYSFVKSIEKLSFRIRTQQLRARVFTQQKNSM
FAILEVEVLFFFVLIFQFYQYVVIIEMIFPLLKIIGGYLQYRFNCGQGEGLVQLHNQLIN
DGKWHEIVVERKGHTVALIMDHKHRSVGSAPGTGSACNRLKTDFYFGGEISSNELNPINV
LQGLVGCLDQILFNGQQIPFHKTSKSSLKTLANIEFSCSLRQEIGVCRSQPCLNGGLCQH
LSNNSYECSCQSGRFVGKHCEIDLQPCSFMPCRNDGICIEDIASCRNGSPNCYRCECRSG
FTGQQCQTIDHCTMNYCQNGGFCEETTIGPKCHCHSGWHGLFCEQDIDECQLPTAACEST
AQCINLPGTYRCVCPLNSTAHCAGHGLLAANILNPYLQITYQELFLLIFSLIILLLIAFA
LVVCCNCCNRSKKRKKKQQKKNRKNSQQQLQAEEDSPELNQSLLMKCNSQNSAFYDPHHR
YLYHLRTNSSNSSSRFEMINMGSISNQIIGNDGQQQQQQDGMQTSGRNQDPNNQSGDDEY
ETSNDCLMIMDFGQALSKKNAPIASVSPQIIIDHNGATHHCCHSKINKKRIRSLINNGQL
LV
Download sequence
Identical sequences A0A131ZWI6
SSCA006940-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]