SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA008164-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA008164-PA
Domain Number 1 Region: 952-1217
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-43
Family YWTD domain 0.00000493
Further Details:      
 
Domain Number 2 Region: 2377-2657
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-37
Family YWTD domain 0.0000233
Further Details:      
 
Domain Number 3 Region: 280-508
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-35
Family YWTD domain 0.0000968
Further Details:      
 
Domain Number 4 Region: 3313-3561
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-33
Family YWTD domain 0.0000265
Further Details:      
 
Domain Number 5 Region: 1625-1816
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-26
Family YWTD domain 0.00015
Further Details:      
 
Domain Number 6 Region: 1338-1554
Classification Level Classification E-value
Superfamily YWTD domain 1.2e-24
Family YWTD domain 0.00023
Further Details:      
 
Domain Number 7 Region: 3-160
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-16
Family YWTD domain 0.00038
Further Details:      
 
Domain Number 8 Region: 727-765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 2264-2302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 2867-2907
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 11 Region: 616-655
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 3070-3113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 13 Region: 2072-2109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 14 Region: 2165-2202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000668
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 1918-1962
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 16 Region: 2915-2954
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000038
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 17 Region: 3000-3034
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 18 Region: 2113-2148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 1965-1998
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000772
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 20 Region: 2706-2743
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 21 Region: 2011-2044
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 22 Region: 2832-2866
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 23 Region: 2747-2787
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 24 Region: 2215-2254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 25 Region: 768-804
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000903
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 26 Region: 3036-3070
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000106
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 27 Region: 2952-2994
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000124
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 28 Region: 1225-1294,1594-1632
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000022
Family Growth factor receptor domain 0.027
Further Details:      
 
Domain Number 29 Region: 3128-3161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 30 Region: 2791-2834
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 31 Region: 576-610
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 32 Region: 2303-2346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000796
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA008164-PA
Sequence length 3969
Comment pep supercontig:SscaA1:JXLN01015925:1313:15568:-1 gene:SSCA008164 transcript:SSCA008164-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTLDWIAKNWYMLDHYNEIIFVCDYRFDHCVSIVDAKLNKPKMLALDPINNGYLFTIEW
GPNALLRRFDLDGLNEKILIQERIVYPSIISLDLANQLIYWFDAYLESIESANYEGLKRR
MLFKNFGDRIIDISAFERKLYLLIARNESYSSITIANIYDFNRTNFQSLEFSKALTDLKI
IHRRRQPIDSAPHPCTIDKGGCDHICLTKFVSNSIKNQSISLEKMAKCKCSTGYIYDDVN
KKCHIDNLSYRIMFVRSRPGSIKIISFNDSNFVDDPIDRNEITISTMPFTRAVYFDFDLR
TQQIFYSNMQRNAIDRFSLNFSSNQSLLASVHIEKGVIQCEGIAIDSDGGNLYWADSTIL
AISVAKINNSNVRKILINSGLNHPKSIILDRLNAKLYWSDWTFNSNGSGRIERATMNGKE
REIIVDEDLVYPNGLAIDRFYIYWCDSYQKRIERANLDGTNRTLINGEKNLGNPYSLAIF
NNHVFWTDYRHGSIRSMNLESRKMKTLLIDSSPLYDLRIIDSRKNFFDETCKRKQCQHLC
LRKSPQEVECYCSDGFELSIDGITCRIIEDYQRPSLCKDVEFECRNISQCIDKQHLCDGD
FDCIDGSDEDTGSGSVCEHASCKEGYFRCDKNRCILSHWVCDGQLDCLDESDEAQFNNCS
DVVCGTKFFKCQISKKCIPDSWVCDSDLDCGFEDRSDEHKDCAESLTVLMSNCSNETLTH
SQHSIASIVCNKTQFRCQIGNCIPQEWHCDGTPDCIDLSDEFNCTELNCHRNEIVCKPLK
QCLNKKTKCDGILDCPDASDELGCDRTILPSENFTCNYPNRNCIHRLSKKNVCLSISKFC
DKISDCQDDQDESDTCEIDACFFAECKDLCHNVPYDPGYVCYCSNGSLALDGISCTDTHP
CDQWRACSQICRPLNKSQIVVSDHSYKCECFDDYYLDPSDNFTCKSIIEASPLLIFTNKN
QIRSIDLYHNSTHLLLSGLKNSIALDFLYYEDQIFIFWSDVIDDRIYRGELIQKTITNIE
PIIEGGLNFAEGLAVDWLAHNIYWIDSNFNQIEVAKIDGNSRNTLLTYGLSNPRAISIDP
NKFKLFWTDWDINRPRIESASMDGRDKRILIDFDPGLWPNGITLDSLLERIYWIDAKTDT
LNTITYDGRDLRIVLSRNELLTHPFAMSLFENYVYWSDWRTNALVRASKWNGSKAKIIGH
TFTQPFDVKILHPSRQPKSANISSKCLIDNGGCSHLCLLSTRTLGNYVCDCPHAMKLDSD
GRGCSQLCLIIAENTRKCLCTVGFRIDPLDETKCIGEQVFLMYSWNWGLRGIPITPINDT
EPLNKQYERKKNSNKEHSLLPPISSIAMASSIDFDSSNEIIYWADSDEGSIAGVNRDTSG
YHKLKKDISKLIDFVFDWNSYNLYWIEEHLGLIEVMKINGSYSHLVLISEEIHKPTSITL
HPGLGFLLWSDIGKNSSSRIERSRLDGSNRTTIYEISKPNTINDLTIDIISNTLYFVDLS
VQQILQINLERSPIKPATVLTNVKSPISIAVYDRFLYWADTNLYGGSIFAIRTDKFIDAA
NLTISLNSTGLTLLECEIGDSILEINVYYRRPIYPQNLCAQNNGECSDFCFYLGAGNGHR
CLCSYGYILYWTRNTDSSIAKINLSFVPSFDDHKSKRLPLMDRNRVETIVNLSPEDRIRG
IALDHCRNLLYWTNWNSKNPSIQRSPNNGKSIIQSVITEDIRMPNSIVIDRSSKHLYWAD
AYLSKIEKCDLDAINCVVLVMKIIQNPFGLAIYGEHLYWTDWSSHSVLRCNKHTGEDIVA
LRRNIVRPMGLVVVAPNDPTLKSENICNLTDYNPCALDNGGCDDVCSENFTTNSFFHQCS
CFEGRQLERDGRRCYSTHSNCSLENGKFECSKSGLCIPLELTCDGIDNCPGDHSDEDRTF
CSSRRCPSDYFKCTDNRCISMDKICDGKIDCPDANDEKKCDCSRQNKFRCQNGLCIAKNF
RCNSVPECSDASDEIDCPRLDCDRIKEAKEPMINCVRTSACISPKWICDGQNDCWDNSDE
ENCPLNSNISLNHFESIEKFNPIESKQLDNSCDVQNQFRCRNGECISIIWGCDGKNDCLD
GSDERIEFCQSNHCSEERYFQCNQMGRCIPRIWLCDGKSDCLDGSDERTGNNEPCEGTNK
TIAFFKERVCNHNEFQCQNFECVQSKFLCDGISDCLDGSDESIEICESNLSEEYRLCSSQ
EYRCRIKSKCIPKSSVCNGIRDCAGGDDESSELCLDFHNISSASNRRCGNDQFQCDNGVC
IDLSLICNGDNDCEDFSDEKKCNINECESELACPQKCEDMPIGYKCSCYDGFEQSNETEI
CSDIDECDRNYCSQLCRYYLDSDGINCRSSSSTPISLLLSARNGIYRIDPIDEKAGSKDL
KIVSNEFDATAIDYDWQENCLYWSEITLVASYIKKSCNFSLTKVQDSEEKSFKINPKNIQ
VLHSNTLQSPECVAIDWIGRNLYWCDKKKPSIEVSRLDGKFRLNLIKENLEEPTAIVLNP
LEGILFWTNYGEKPHIGKASMDGSNHRIILEDSLGWPSALTIDFIRRLLYFADAREDYIG
TIDFYGQNRKIILDKSTRYTSHIFSMSFFENRLYWTDWRSSSVISCPVTNCTSDHLKSQI
TFTKPMDIKVWHPDRQPLRSQKNPCLNKLNSDSGCMALCLLRNDAGKFSSSCACPENYIL
DENQYTCRSNCSRSEFVCNSTYKCIPFWWKCDTQDDCGDGSDEPADCEPFHCIPDQFQCR
VQSQCILPQQICDGILNCIDKTDEIDCDNHVCMANQFKCPAFNNSTAYCISAMNRCDGSN
DCPNGEDEIECDCPRTAFKCANKKCISKEWECDGEDDCGDMSDEYADCSQRVCGPMHFRC
DSGRCIPESWRCDNEPDCSNHQDEIGCDHNENKTFSSFCDENHFRCDNERCVDFLYRCDL
DEDCGDGSDESNCTVDVCTDNKFSCDNGYKCLNEEFRCNGAYDCVDLSDEFNCQYKCDEE
EEFRCSNSAMCILSQWKCDGDFDCSDGSDEINCTNKCSLKDFTCKSIQQCIYGPWRCDGE
KDCLDGSDEDLSMCSRLVCPVNKFRCDNSICLSKLKLCNGIDDCGDNSDESQEICKKRHQ
SCTIESNTDMFQCSLSKQCFDISLKCDGSEDCDDGSDEFDCPGSSKLQLFHSFDESCPFG
LCSQTCINKIKHSYSLISFPNASIENTSYRSNSSHLTCQCSEGYVEKKLPYYHNVTAGSY
IPQISTCQAKGNDAILLATSDLGFRVVNSYKNLLQELYDLFLFSSDPNSNTTSAFNRSYV
SKMESFDYYYENNKTTIFWTNPHQNFIAAMRIETIENKLHWNSKQKLSLEQKNHLAISIV
SEEPKILVKNIENLRGIAIDWISHYLYWIQSTPPSIKLSNFDGSRIKTLISSQPLEQPYD
IVVDPKNCFLFWSDWSHTTSIRIGRANLDGSQIHPLINTDIEWPLGLALDFEANRLYYTD
PKLSIIECIKIDGSDRRKIYALHRHHHKPYRIDVWEDYIFVTTLPNREILKLNKFGDNQW
MTLAKNIPKLNDIAIVHRLKQRKNLINVCEVNPCTSESFLCIAKQPQNRVCVCPDGYQPN
KNQCELLVAKLEESKNLTETHCDCLNEGKCRYLNGSQYCDCNPMFEGSRCERFRCSGYCH
NHGLCYLDMTNITKENRDRGQLRCICPFGLIGDRCEIVIKSCTDQLDYCYNQGLCLQESS
DVIKCECKSGFYGDRCQICSDLFCQNGYCTKNVGQSRCECAQGFYGFHCESHSCSRKLCQ
NQGECFFNSLHNFTIEENFRFKCDCDNGFYGTRCEKTVNTNGIVKGSVSDPIDVTFPTHR
SHQMVIYAILLLLALFSIVIIVLHLHKSFRIKVQRELAFQHRRIPETNLPLNGFDVEIIN
PVFNPDNNLDSFNEMAISKSANDQQPSQSSAILDYTKQNNFENPVYEYRNISARSEENPE
EMENLLKTS
Download sequence
Identical sequences A0A132AIP1
SSCA008164-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]