SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA008423-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA008423-PA
Domain Number 1 Region: 251-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000122
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 2 Region: 350-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000544
Family EGF-type module 0.019
Further Details:      
 
Domain Number 3 Region: 92-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000452
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 147-287
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 34-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000879
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA008423-PA
Sequence length 561
Comment pep supercontig:SscaA1:JXLN01011511:20918:22679:1 gene:SSCA008423 transcript:SSCA008423-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQCRFGERPINGECRQVACGIGFFYNETDKRCQDMNECLEYRPCKQTETCTNTIGSYRC
GNRCNSGYRLKSNHPDAHQAYRDEHGDHHRSCIDIDECETGQFVCPPDKQCKNRPGSFTC
ECREGFQQLPNGTCIDIDECLQGDTIVCPSSSKLTCINTIGSYRCECQKGYRKQMLSSSQ
LKSNSDSITKSATNPKDSKDFQNESKFYCVDIDECQSGYDLSTKSESNSFNDVSKQSSIA
SSYQYPYFSLNQCQHYCQNYPGSYRCSCRAGYRLSSDGHSCIDEDECQMFRLDSTENLNE
FDDDLDIEESSIVEAIPNSVGSIRSISSPHSSPLSSSSSSSSETSLSSIRSSICYYKCTN
VPGSFRCVCPKGYQTLNDGLLCKDIDECEQTSICGEDQFCLNLRGGYRCIKIDCPSEEYF
FEIKNKRCVRMLEGVMGYRDLTKPISYSYQYLSIVSRIRISDSLRYLDLVSIDGRLFSIP
DIRYDLTLKSVRTVLDEKHRARREDFILRKSKIDQIIVSLIRSLQGPQDIELELTVSLYP
NDQLKGMTKTFIYIVVSKYTF
Download sequence
Identical sequences A0A132A8N8
SSCA008423-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]